KEGG   Pseudomonas aeruginosa DK2: PADK2_25210Help
Entry
PADK2_25210       CDS       T02161                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PADK2_25210 (tpiA)
   01230 Biosynthesis of amino acids
    PADK2_25210 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PADK2_25210 (tpiA)
   00051 Fructose and mannose metabolism
    PADK2_25210 (tpiA)
   00562 Inositol phosphate metabolism
    PADK2_25210 (tpiA)
Enzymes [BR:pdk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PADK2_25210 (tpiA)
Exosome [BR:pdk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PADK2_25210 (tpiA)
  Exosomal proteins of bladder cancer cells
   PADK2_25210 (tpiA)
  Exosomal proteins of melanoma cells
   PADK2_25210 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5434185..5434940)
Genome map
AA seq 251 aa AA seqDB search
MRRPLVAGNWKMHGTHSSVAELIKGLRQLALPSGVDVAVMPPCLFISQVIQGLAGEAIDV
GAQNSAVEPMQGALTGETAPSQLADVGCSMVLVGHSERRLILGESDEVVSRKFAAAQSCG
LVPVLCVGETRAEREAGKTLEVVARQLGSVIDELGVGAFARAVVAYEPVWAIGTGLTASP
AQAQEVHAAIRAQLAAENAEVAKGVRLLYGGSVKAASAAELFGMPDIDGGLVGGASLNAD
EFGAICRAAGS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgacccttggtggccggtaactggaaaatgcacggtacgcattccagtgtggcc
gagttgatcaaaggcttgcgtcagctggcgttgccgagcggagtcgatgtagctgtgatg
ccaccttgcttgttcatcagccaggtcatccagggcctggccggcgaggcgatcgatgta
ggtgcgcagaacagcgccgtcgagccgatgcaaggcgcgctgaccggtgagactgctccc
agtcagttggcggatgtcggttgtagcatggtcctcgtgggccactcagagcgtcgcctg
attctcggcgagagtgacgaggttgtgagtcgcaagtttgccgcggctcagtcgtgcggc
ctggtgccggtgctgtgtgtcggggagacccgggcggagcgcgaggcgggcaagacgctg
gaggttgtcgcaaggcagctgggaagcgtgatcgacgagttgggtgttggagcttttgct
cgcgcagtcgtggcttacgagccggtctgggcgatcgggaccgggttgaccgcgtccccc
gcgcaagcccaggaagtgcacgcggcgatccgcgcgcaactggcagcggaaaatgccgag
gtcgcaaaaggtgtgcgactcctttacggcggcagtgtaaaggcggcaagtgcagccgag
ttgttcggcatgccggatatcgatggggggctggtaggtggagcctccctcaatgcggat
gagttcggcgcgatctgtcgtgccgcgggaagctga

DBGET integrated database retrieval system