KEGG   Pseudomonas aeruginosa DK2: PADK2_25210Help
Entry
PADK2_25210       CDS       T02161                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk00010  Glycolysis / Gluconeogenesis
pdk00051  Fructose and mannose metabolism
pdk00562  Inositol phosphate metabolism
pdk01100  Metabolic pathways
pdk01110  Biosynthesis of secondary metabolites
pdk01120  Microbial metabolism in diverse environments
pdk01130  Biosynthesis of antibiotics
pdk01200  Carbon metabolism
pdk01230  Biosynthesis of amino acids
Module
pdk_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PADK2_25210 (tpiA)
   00051 Fructose and mannose metabolism
    PADK2_25210 (tpiA)
   00562 Inositol phosphate metabolism
    PADK2_25210 (tpiA)
Enzymes [BR:pdk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PADK2_25210 (tpiA)
Exosome [BR:pdk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PADK2_25210 (tpiA)
  Exosomal proteins of bladder cancer cells
   PADK2_25210 (tpiA)
  Exosomal proteins of melanoma cells
   PADK2_25210 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFM67305
Position
complement(5434185..5434940)
Genome map
AA seq 251 aa AA seqDB search
MRRPLVAGNWKMHGTHSSVAELIKGLRQLALPSGVDVAVMPPCLFISQVIQGLAGEAIDV
GAQNSAVEPMQGALTGETAPSQLADVGCSMVLVGHSERRLILGESDEVVSRKFAAAQSCG
LVPVLCVGETRAEREAGKTLEVVARQLGSVIDELGVGAFARAVVAYEPVWAIGTGLTASP
AQAQEVHAAIRAQLAAENAEVAKGVRLLYGGSVKAASAAELFGMPDIDGGLVGGASLNAD
EFGAICRAAGS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgacccttggtggccggtaactggaaaatgcacggtacgcattccagtgtggcc
gagttgatcaaaggcttgcgtcagctggcgttgccgagcggagtcgatgtagctgtgatg
ccaccttgcttgttcatcagccaggtcatccagggcctggccggcgaggcgatcgatgta
ggtgcgcagaacagcgccgtcgagccgatgcaaggcgcgctgaccggtgagactgctccc
agtcagttggcggatgtcggttgtagcatggtcctcgtgggccactcagagcgtcgcctg
attctcggcgagagtgacgaggttgtgagtcgcaagtttgccgcggctcagtcgtgcggc
ctggtgccggtgctgtgtgtcggggagacccgggcggagcgcgaggcgggcaagacgctg
gaggttgtcgcaaggcagctgggaagcgtgatcgacgagttgggtgttggagcttttgct
cgcgcagtcgtggcttacgagccggtctgggcgatcgggaccgggttgaccgcgtccccc
gcgcaagcccaggaagtgcacgcggcgatccgcgcgcaactggcagcggaaaatgccgag
gtcgcaaaaggtgtgcgactcctttacggcggcagtgtaaaggcggcaagtgcagccgag
ttgttcggcatgccggatatcgatggggggctggtaggtggagcctccctcaatgcggat
gagttcggcgcgatctgtcgtgccgcgggaagctga

DBGET integrated database retrieval system