KEGG   Pseudomonas aeruginosa DK2: PADK2_26080Help
Entry
PADK2_26080       CDS       T02161                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:pdk00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5617908..5618567
Genome map
AA seq 219 aa AA seqDB search
MNRPSKIASFDVDAQKGFTPLCPDELPVPGGDAIGAALNQLASRAALRLGSKDAHSPKAA
WVVESAEQMLRPLAYPDADLTWVNHCVPGTPGFELLDELPRPIDYDFFVWKGVEPDLHPY
GACYHYLAERRSTGVIEYLRQNGVSHVLVGGLALDYCVKNTALQLRRAGFEVLLYLPACR
AIAEDTAQRACDEMRDAGVILCADLERLDSALAGADKEK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtcccagcaagatcgccagcttcgatgtcgacgcccagaaaggcttcaccccg
ctgtgcccggacgaactgccggtgcccggcggcgacgccatcggcgccgccctcaaccaa
ctggccagccgcgccgcgctgcgcctgggcagcaaggacgcgcacagcccgaaggctgcc
tgggtagtggaaagcgccgagcagatgctgcggccgctggcctatccggatgccgacctg
acctgggtgaaccactgcgtaccgggtacgccgggtttcgagctgctcgacgaactgccg
cggccgatcgactacgacttcttcgtctggaagggcgtggagccggacctgcatccctac
ggcgcctgctaccactatctggcggaacgccgcagcaccggggtcatcgaatacctgagg
cagaatggcgtgagccatgtgctggtgggtggcctggcgctggactactgcgtgaagaac
accgccctgcaactgcgccgcgccggtttcgaggtgctgctctacctgcccgcctgccgg
gccatcgccgaggacaccgcgcagcgggcctgcgacgagatgcgcgacgccggggtgatc
ctctgcgccgacctggaacgactggatagcgccctcgccggcgccgacaaggagaagtga

DBGET integrated database retrieval system