KEGG   Pseudomonas aeruginosa DK2: PADK2_28345Help
Entry
PADK2_28345       CDS       T02161                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PADK2_28345
   00030 Pentose phosphate pathway
    PADK2_28345
   00051 Fructose and mannose metabolism
    PADK2_28345
   00052 Galactose metabolism
    PADK2_28345
   00500 Starch and sucrose metabolism
    PADK2_28345
   00520 Amino sugar and nucleotide sugar metabolism
    PADK2_28345
  Nucleotide metabolism
   00230 Purine metabolism
    PADK2_28345
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PADK2_28345
Enzymes [BR:pdk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PADK2_28345
    5.4.2.8  phosphomannomutase
     PADK2_28345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
6128146..6130752
Genome map
AA seq 868 aa AA seqDB search
MKLFQRTAKDGNELGDLLEPEKKPRKAASERADGKDLLPGIGASLLGVAAAGALLWFGVF
GGAGEAQQRQLDAAWAEGQAGALRQALQQLCADTRAAAASPLALEALQSGDATRIEAAQR
SLLAWDGVVDAHLNAPGQAAQDNDSPGPVSFAALDILHRVESGQNVAAEAYKVGQRWLLY
SAAPVRGADQSLQGTLLLAVDLQRLLRALPPLPGDAGQVQLVQQFSGAPAQVLLQRGTPA
PGKGAQALDSGNPNWKLNYTPGSVASTQASPLLLALAALLALLGGILGTYLTRSSLLRRL
HQDVLTLGQYLQELGGQRTAKPPVPSLPGFAPLIQALARQPRRKPEPTSVPSPAKAAPVA
PVAVAKAPPREEPALADPLFQNTDILDIDILDEDQDLLGLEQTPIMSTAKAPTLPASIFR
AYDIRGVVGDTLTAETAYWIGRAIGSESLARGEPCVAVGRDGRLSGPELVKQLIQGLVDC
GCQVSDVGMVPTPVLYYAANVLEGKSGVMLTGSHNPPDYNGFKIVVAGETLANEQIQALR
ERIEKNDLASGVGSVEQVDILPRYFKQIRDDIAMAKPMKVVVDCGNGVAGVIAPQLIEAL
GCSVIPLYCEVDGNFPNHHPDPGKPENLKDLIAKVKAENADLGLAFDGDGDRVGVVTNTG
TIIYPDRLLMLFAKDVVSRNPGADIIFDVKCTRRLIALISGYGGRPVMWKTGHSLIKKKM
KETGALLAGEMSGHVFFKERWFGFDDGIYSAARLLEILSQDQRDSEHVFSAFPSDISTPE
INITVTEDSKFAIIEALQRDAQWGEGNITTLDGVRVDYPKGWGLVRASNTTPVLVLRFEA
DTEEELERIKTVFRNQLKAVDSSLPVPF
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttttccagcgcaccgccaaggatgggaacgagttgggcgacctgctcgaaccg
gaaaagaagccgcgcaaggcagcgtccgaacgcgctgacggcaaggacctgctgcccggc
ataggcgccagcctactgggcgtggcggccgccggcgccctgctctggttcggcgtcttc
ggcggcgccggtgaggcgcagcagcgccagttggacgcggcctgggccgaaggccaggcc
ggcgccttgcgccaggccttgcagcaactctgcgccgacacccgcgccgccgcggccagc
cccctcgccctcgaagccctgcaaagcggcgacgccacccgcatcgaggccgcccagcgc
agcctgctggcctgggacggcgtggtcgatgcccacctgaacgcgcccggccaggccgcc
caggacaacgacagccccggcccggtcagcttcgccgccctggatatcctgcaccgggtg
gaaagtggccagaacgtcgccgccgaagcctacaaggtcggccagcgctggttgctgtac
agcgccgcgccggtgcgcggcgccgaccagagcctgcaaggcacgctgctgctggcggtc
gacctgcaacggctgctgcgcgccctgccgcccttgccgggcgatgccggccaggtacaa
ctggtccagcagttctccggcgcaccggcccaggtgctgctgcaacgcggtacgccggcg
ccgggcaagggtgcgcaagcgctggacagcggcaatccgaactggaaactgaactacacg
cccggcagcgtcgcttcgacccaggcctcgccgctgctgctggcactcgcggcgctgctg
gccctgctcggcggcatcctcggcacctacctcacccgttcgtcgctgttgcgccgcctg
catcaggatgtcctgaccctcggtcagtatcttcaggaactcggcgggcaacgcactgcc
aaaccccctgtgcctagcctgccgggcttcgccccgctgatccaggcattggcccgccag
ccgcggcgcaagccggagccgaccagcgtgcccagccctgccaaggcagcgccggtggcg
ccggtggcggtggcgaaagcgcctcctcgcgaggagccggcattggcagatccgttgttc
cagaacaccgacattctggatatcgacattctcgatgaagaccaggacctcctgggattg
gagcaaacccccatcatgagcactgcaaaagcaccgacgctgcccgccagcatcttccgc
gcctacgacatccgtggcgtggtaggcgataccctcaccgccgagaccgcctactggatc
ggtcgcgccatcggctcggaaagcctcgcccgcggcgaaccgtgcgtcgctgtcggccgc
gatggccgcctgtccggtcccgagctggtcaagcagctgatccagggcctggtggactgc
ggttgccaggtcagcgacgtgggcatggtgcctaccccggtgctgtactacgcggccaac
gtgctcgagggcaagtccggggtgatgctgaccggcagccacaatccgccggactacaac
ggcttcaagatcgtggtcgccggcgagaccctggccaacgagcagatccaggccctgcgc
gagcgcatcgagaaaaacgacctggcatccggcgtcggcagcgtagagcaggtcgacatc
ctgccgcgctacttcaagcagatccgcgacgacatcgccatggccaagccgatgaaggtg
gtggtcgactgcggcaacggcgtggccggggtgatcgccccgcagttgatcgaggccctg
ggctgcagcgtgatcccgctgtactgcgaggtcgacggcaacttcccgaaccaccatccg
gacccgggcaagccggagaacctgaaggacctgatcgccaaggtcaaggccgagaacgcc
gacctgggcctggccttcgacggcgacggcgatcgcgtcggcgtggtcaccaataccggt
accatcatctatccggaccgtctgctgatgctgttcgccaaggacgtggtctcgcgcaac
ccgggggccgacatcatcttcgacgtcaagtgcacccgccgtctgatcgccctgatcagc
ggctacggcggccgtccggtgatgtggaagaccggccactcgctgatcaagaagaagatg
aaggaaaccggcgccctgctggctggcgagatgagcggccacgtgttcttcaaggagcgc
tggttcggcttcgacgatggcatctacagcgccgcccgcctgctggaaatcctcagccag
gatcagcgtgacagcgagcacgtgttctcggccttcccgagcgacatttccaccccggaa
atcaacatcaccgtcaccgaggacagcaagttcgccatcatcgaggcgctgcaacgcgac
gcccaatggggcgaaggcaacatcaccaccctcgacggcgtgcgggtcgactaccccaaa
ggctggggcctggtacgcgcctccaacaccactcccgtgctggtcctgcgcttcgaagcg
gacaccgaggaagagctggagcgcatcaagaccgtcttccgtaaccaactgaaggcagtg
gattcctcgctgcccgtgcccttctga

DBGET integrated database retrieval system