KEGG   Pseudomonas aeruginosa DK2: PADK2_28840Help
Entry
PADK2_28840       CDS       T02161                                 

Definition
glutathione-independent formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pdk01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:pdk00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:pdk00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
6238859..6240058
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGPGKVEVQNIPYPKMQDPQGRQIDHGVILRVVSTNICGSDQHMVRGRTTA
PEGLVLGHEITGEVVEIGRGVETMKIGDLVSVPFNVACGHCRTCKEQHTGVCLTVNPARA
GGAYGYVDMGGWVGGQAEYVLVPYADFNLLKLPNREAAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYIAGAGPVGLAAAASARLLGAAVVIVGDVNPTRLAHAKKQGFEIADLSKD
TPLHEQIAALLGEPEVDCAVDAVGFEARGHGHSGSQQEAPATVLNSLMGITRVAGKIGIP
GLYVTEDPGAVDAAAKHGALSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRIKIA
DIVGVEVITLDDAPKGYGEFDAGVPKKFVIDPHNLFRAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcaatcgtggtgtggtctatctcggcccgggcaaggtcgaggtgcagaacatt
ccctatccgaagatgcaggacccgcagggccggcagatcgaccacggggtgatcctgcgg
gtggtctccaccaacatctgcggctccgaccagcacatggtgcgcggccgtaccaccgcg
ccggaaggcctggtgctgggccacgagatcaccggcgaggtggtggagatcgggcgtggc
gtggaaaccatgaagatcggcgacctggtctcggtaccgttcaacgtcgcctgcggccac
tgccgtacctgcaaggaacagcacaccggcgtctgcctgacggtcaatccggcgcgtgcc
ggcggcgcctacggctacgtcgacatgggtggctgggtcggcggccaggccgaatacgtg
ctggtgccctacgccgacttcaacctgctgaaactgcccaaccgcgaagcggcgatggag
aagatccgcgacctgacctgcctttcggacatcctccccaccggctaccacggcgcggtc
accgccggcgtcggcccgggcagcacggtctacatcgccggcgccggtccggtcggcctg
gccgcggcggcctcggcacgcctgctcggcgcggcggtggtgatcgtcggcgacgtcaac
ccgacccgcctggcccacgccaagaaacagggcttcgagatcgccgacctgtccaaggac
accccgctgcacgaacagatcgccgctctactgggcgagccggaggtcgactgcgcggtc
gatgcggtcggtttcgaggcgcgcggccacggccattcgggctcgcagcaggaagccccg
gccaccgtgctcaactcgctgatgggcatcacccgggtcgccggcaagatcggcatcccc
ggcctgtacgtcaccgaagacccgggcgcggtggacgcggccgccaagcacggcgccctg
agcatccgcttcggcctgggctgggccaagtcgcacagcttccataccggccagaccccg
gtgatgaagtacaaccgccagctgatgcaggcgatcatgtgggaccggatcaagatcgcc
gacatcgtcggggtggaagtcatcaccctcgacgatgcgccgaaaggctacggcgagttt
gacgccggggtgccgaagaaattcgtcatcgacccgcacaacctgttccgcgcggcctga

DBGET integrated database retrieval system