KEGG   Pseudomonas aeruginosa DK2: PADK2_28845Help
Entry
PADK2_28845       CDS       T02161                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PADK2_28845
Enzymes [BR:pdk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PADK2_28845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6240181..6241098
Genome map
AA seq 305 aa AA seqDB search
MNTDSPINRVEQVQVDDLACWRIHTAHGEALIAQQGAQLLSYQPHEQPPLVWLSDEAGYR
RGQSVRGGVPVCWPWFGPLERNPQEVRGQVEDGLKAPAHGLVRAVDWEIDDIAEEDGDLC
VSFRLDAPDGLPGWPHPAALRMLFRFGERLTLRLTSENLGSKPLVLSQALHTYFAVSDSR
EIAIEGLEGARYIETLENWEERTQHGAVRVKGELDRIYLGLERDLLIKDPRWERSIHLHA
LDSRSAVVWNPWVDKSRRLSQFADDAWQQMLCIETGRVWDDLMVVAPGRSESFGVQIWSE
PLKRP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgatagcccgatcaaccgcgtcgaacaggtacaggtcgacgacctggcctgc
tggcgcatccacaccgcccatggcgaggcgctgatcgcccagcagggcgcgcaactgctc
agctaccagccccacgaacagccgccgctggtctggctcagcgacgaggccggctaccgg
cgcgggcagtcggtacgcggcggggtgccggtgtgctggccgtggttcggtccgctggag
cgcaacccgcaggaagtccgcggccaggtggaagatggcctgaaggcgcccgcccacggg
ctggtccgggcggtcgactgggaaatcgacgacatcgccgaggaggacggcgacctctgc
gtcagcttccgtctcgacgcccccgatggcctccccggctggccgcacccggcggcgctg
cgcatgctgttccgcttcggcgagcgcctgaccctgcgactcaccagcgagaacctcggc
agcaagccgctggtgctcagccaggcactgcacacctacttcgcggtcagcgacagccgc
gagatcgccatcgagggcctggaaggcgcgcgctacatcgagaccctggagaactgggaa
gaacgcactcagcacggcgcggtacgggtcaagggcgaactggatcgcatctacctcggt
ctcgaacgcgacctgctgatcaaggacccgcgctgggaacgcagcatccacctgcacgcc
ctcgactcgcgctcggcggtggtctggaacccctgggtggacaagtcccggcgtctctcg
cagttcgccgacgacgcctggcagcagatgctctgcatcgagaccgggcgggtctgggac
gacctcatggtggtcgcccccgggcgcagcgaaagctttggcgtgcagatctggagcgag
ccgctgaaacgaccctga

  All links  
No link information was found.   
DBGET integrated database retrieval system