KEGG   Pseudomonas aeruginosa DK2: PADK2_28870Help
Entry
PADK2_28870       CDS       T02161                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk00010  Glycolysis / Gluconeogenesis
pdk00071  Fatty acid degradation
pdk00350  Tyrosine metabolism
pdk00625  Chloroalkane and chloroalkene degradation
pdk00626  Naphthalene degradation
pdk01100  Metabolic pathways
pdk01110  Biosynthesis of secondary metabolites
pdk01120  Microbial metabolism in diverse environments
pdk01130  Biosynthesis of antibiotics
pdk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PADK2_28870
  Lipid metabolism
   00071 Fatty acid degradation
    PADK2_28870
  Amino acid metabolism
   00350 Tyrosine metabolism
    PADK2_28870
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PADK2_28870
   00626 Naphthalene degradation
    PADK2_28870
Enzymes [BR:pdk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PADK2_28870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C TrkA_N 2-Hacid_dh_C adh_short_C2 Methyltransf_25 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AFM68035
Structure
PDB: 

Jmol
Position
6244086..6245114
Genome map
AA seq 342 aa AA seqDB search
MTLPQTMKAAVVHAYGAPLRIEEVKVPLPGPGQVLVKIEASGVCHTDLHAAEGDWPVKPP
LPFIPGHEGVGYVAAVGSGVTRVKEGDRVGIPWLYTACGCCEHCLTGWETLCESQQNTGY
SVNGGYAEYVLADPNYVGILPKNVEFAEIAPILCAGVTVYKGLKQTNARPGQWVAISGIG
GLGHVAVQYARAMGLHVAAIDIDDAKLELARKLGASLTVNARQEDPVEVLQRDIGGAHGV
LVTAVSNSAFGQAIGMARRGGTIALVGLPPGDFPTPIFDVVLKGLHIAGSIVGTRADLQE
ALDFAGEGLVKATIHPGKLDDINQILDQMRAGQIEGRIVLEM
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgccacagaccatgaaagccgcggtcgtgcacgcctacggcgcgccgctgcgg
atcgaggaagtcaaggttccgctgcccggccccgggcaggtactggtgaagatcgaagcc
tccggcgtctgccacaccgacctgcacgccgccgagggcgactggccggtgaagccgccg
ttgccgttcattcccggtcacgaaggcgtcggctacgtcgccgcggtgggcagcggagtg
acccgggtgaaggaaggcgaccgggtcggcatcccctggctgtacaccgcctgcggctgc
tgcgagcactgcctgaccggctgggagaccctctgcgagagccagcagaacaccggctac
tcggtgaacggcggctatgccgaatacgtattggccgacccgaactacgtcggaattctg
ccgaaaaacgtcgaattcgctgaaatcgcgccgatcctctgcgccggcgtcaccgtctac
aaggggctcaagcagaccaacgcgcgccccggccagtgggtggcgatctccggcatcggt
ggcctcggccacgtcgccgtgcagtacgccagggccatgggcctgcacgtcgccgccatc
gacatcgacgacgccaagctggaactggcgcgcaagctcggtgccagcctgacggtcaac
gcccggcaggaagacccggtggaggtgctccagcgcgacatcggcggcgcccacggggtg
ctggtcaccgcggtatccaacagcgccttcggccaggccatcggcatggcgcgccgcggc
ggcaccatcgccctggtcggcctgccgccgggtgacttcccgacgccgatcttcgacgtg
gtgctcaagggcctgcacatcgccggctccatcgtcggcacccgcgcggaccttcaggaa
gccctcgactttgccggcgaaggcctggtcaaggcgaccatccatccgggcaagctggac
gacatcaaccagatcctcgaccagatgcgcgccgggcagatcgaggggcgcatcgtcctc
gagatgtga

DBGET integrated database retrieval system