KEGG   Pseudomonas aeruginosa DK2: PADK2_29175Help
Entry
PADK2_29175       CDS       T02161                                 

Definition
GGDEF domain-containing protein
Orthology
K13590  
diguanylate cyclase
Organism
pdk  Pseudomonas aeruginosa DK2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6315002..6317017)
Genome map
AA seq 671 aa AA seqDB search
MSRDDVQRWKDKYLENIEQQERLQRRWDARIDLLRRGLVRSSLAAEGSDKAVDQCMKELR
EILRRDDMDAGLSGLIPRLEKAVLDSEQRRQQRTQQNIDALGELAQQLLALDLPRELRKP
LKQFARDIEERARQSREIPILLSELSRLQRQALAERKGGDAEDGRPSLLQRLFGGKESET
TAEPSASVPSVVAASNTPIQPAAAAPSLPVAEHDEAPGGPPQPLPARTVAAIESAPAGWV
GVAERGEPNQILLDEPREIWLDSLPLPAGLSFSETLEEAGAEPSPAMPADVESAPEAPAT
PVDNLDGQAVDEAYELPPPIPEPGYSAVAPHIEASLLRLLDGLSLPSSHQPQAEALRERI
DGSLNWYELVPVLDDLAVLVLSLADSGQRDFEEYLRQLNERLESFLGHLGDAHAGYTDVL
DNARGFDQSLREQVSGLQASVQQATDLNSLKLAVDSRLNGLLASMDEHQREQAEHEQEVS
GRLQALMERVNSMEQDAKAFHSHLEDQRQKALTDPLTGLPNRAALSERLEQEVARRHRDG
GDLLLAVLDIDHFKRINDDFGHLAGDKVLKIIAGELRKRLRQADFIARFGGEEFVVLLPA
TSLEAGRQLLERLRAAIAACPFHFKGEPLSITCSAGITAFEGNEAGEAVFERADQALYRA
KRAGRDRLEVA
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcgacgacgtccagcgctggaaagacaagtacctggagaacatcgagcagcag
gagcgcctgcaacggcgctgggatgcccggatcgacctgctgcgtcgcggcctggtgcgt
agcagtctggcggccgaaggcagcgacaaggcggtcgaccagtgcatgaaggagctgcgc
gagatcctccgtcgcgacgacatggacgccggcctgtcgggcctgattccgcgcctggaa
aaggccgtgctcgactccgaacaacgccgccagcaacgcacccagcagaacatcgatgct
ctcggcgaactggcccagcagttgctggccctggacctgccgcgggaactgcgcaagccg
ctgaagcagttcgcccgcgatatcgaggagcgcgcccggcagtcgcgcgagattccgatc
ctgctcagcgagctgagcaggctgcaacgccaggcgctggccgagcgcaagggcggcgat
gccgaagacggtcgcccgagcctgttgcaacgcctgttcggcggcaaggagtcggaaacc
accgcggagccgagcgcatcggtgccgtccgttgtggcggcaagcaatacaccgatccaa
ccggcggcggccgcgccgtccctgccggtcgccgagcacgacgaggcgccaggcggtccg
ccgcagccgttgcccgcccgcacggtcgccgccatcgaaagcgcgccagcgggttgggtc
ggggtcgccgagcgtggcgagccgaaccagatcctgctggatgagccccgggaaatctgg
ctcgacagcctgccgctaccggccggcctgagctttagcgagacgctggaagaagcgggt
gcggagccgtcgcccgcaatgccggcggacgttgaaagcgcgcccgaagctccggccact
cctgtggataacctcgacgggcaggcggtagacgaggcctacgaactgccgccgccgata
ccggagcccggctacagcgcggtggcgccgcacatcgaggccagcctgctgcggctgctc
gacggcctgtccctgccgagcagccaccagccccaggccgaggcgctgcgggagcggatc
gatggcagcctgaactggtatgagctggtgccggtactcgacgacctggcggtgctggtg
ctgtccctggcggacagtggccagcgcgacttcgaggaatacctgcggcaactcaacgag
cgcctggaaagcttcctcggccacctgggcgacgcccacgccggctataccgacgtgctg
gacaacgcgcgcggcttcgaccaatcgctgcgtgagcaggtcagtggcctgcaggccagc
gtgcagcaggcgaccgacctgaacagcctcaagctggcggtggacagccggctgaacggc
ctgcttgcctccatggacgaacaccagcgcgaacaggccgagcacgaacaggaggtgtcc
ggccgcctgcaggcgctgatggagcgggtcaacagcatggagcaggatgccaaggcgttc
cacagccacctggaggaccagcgacagaaagccctgaccgatccgctgaccggcctgccc
aaccgcgcggcgctcagcgagcgcctggaacaggaagtggcgcgccggcaccgggacggc
ggcgatctgctgctggcggtgctggacatcgaccacttcaagcggatcaacgacgacttc
ggccacctggccggggacaaggtgctgaagatcattgccggcgaattgcgcaaacggttg
cggcaggccgatttcatcgcccgtttcggcggcgaggagttcgtcgtcctgctcccggcc
acgtccctggaagccggccggcaactgctcgaacggctgcgcgcggcgatcgccgcctgt
ccgttccatttcaagggcgagcccctgagcatcacctgttccgccggcatcaccgcgttc
gaaggcaacgaggccggcgaagcggttttcgagcgtgccgaccaggcgctgtatcgagcc
aagcgcgccggccgggaccgcctggaagtggcctga

DBGET integrated database retrieval system