KEGG   Prevotella denticola: HMPREF9137_0089Help
Entry
HMPREF9137_0089   CDS       T01459                                 

Definition
peroxiredoxin HYR1 (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pdn  Prevotella denticola
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    HMPREF9137_0089
  Metabolism of other amino acids
   00480 Glutathione metabolism
    HMPREF9137_0089
Enzymes [BR:pdn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HMPREF9137_0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(98762..99310)
Genome map
AA seq 182 aa AA seqDB search
MRTVYEFSVKDRKGKEVSLKEYANEVLLIVNTATKCGFTPTYDQLEALYEKYHAQGFEVL
DFPCNQFGQQAPGTDESIHEFCKLTYGTEFPRFKKVKVNGDDADPLFKFLKEQKGFAGWD
ESHELYPVLDKMLSEADPDYKEKSDIKWNFTKFLINKKGQVVARFEPTEKIENIAKQIEA
LL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagtttatgaattctctgtcaaggacagaaaaggaaaagaagtatcattgaaa
gagtatgccaacgaggtgctgctgattgtcaacacagctaccaagtgcggcttcacacct
acctacgaccagctggaagcactctatgagaagtaccatgcacagggttttgaggttctc
gatttcccctgcaaccagttcggacagcaggctccgggtaccgacgagagcatccatgag
ttctgcaagctcacctacggaacagaattcccgcgcttcaagaaagtgaaagtgaatggc
gacgatgccgatccgctcttcaagtttctcaaggagcagaagggatttgccggctgggac
gaatcgcacgagctttatcctgttctcgacaagatgctttctgaagctgatcctgactac
aaggagaaatctgatatcaaatggaacttcaccaagttcctgatcaacaagaaggggcag
gtcgtcgcccgctttgaaccgacagagaagatagagaatatcgctaagcagatcgaggct
ctgctgtag

DBGET integrated database retrieval system