KEGG   Prevotella denticola: HMPREF9137_0194Help
Entry
HMPREF9137_0194   CDS       T01459                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pdn  Prevotella denticola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF9137_0194
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF9137_0194
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF9137_0194
Enzymes [BR:pdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF9137_0194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(213325..214686)
Genome map
AA seq 453 aa AA seqDB search
MAHQKRYLLDEQDIPTQWYNIQADMPVKPLPPLHPVTHKPMKAEDLAEIFSMECSRQELD
TEHAWIDIPEEVLDMYRYYRSTPLVRAYALEKALDTPAHIYFKNESVNPLGSHKVNSALP
QCYYCKQESVTNVTTETGAGQWGAALSYAAKVFGLEAAVYQVKISMQQKPYRSLIMRAFG
AMVEGSPSMSTRAGKDIVTRDPMHPGSLGTAISEAIELARTTPRCKYTLGSVLNHVALHQ
TIIGLEAEKQMTMAGEYPDKVIACFGGGSNFGGIAFPFMRHSLLDGRHTEFIAAEPDSCP
KLTRGRFEYDFGDEAGYTPLLPMYTLGHDFKPANIHAGGLRYHGAGVIVSQLIKDGYMHG
MDIPQLESFEAGILFSRTEGIIPAPESCHAIAATIREAKKAKESGRQEVLLFCLSGHGLI
DMIAYDSYINGDLQNYTLSDEDIVRNLQTVPKV
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcacaccagaaaagatacctgctcgacgagcaggacattcccacacagtggtacaac
attcaggcggatatgccggtcaaaccgcttcctcccctccatcctgtcacccacaaaccc
atgaaagccgaggatcttgccgagatcttcagcatggaatgttcccgtcaggagcttgac
acggagcacgcatggattgacattccggaagaggtgctggatatgtaccggtattaccgt
tcgacaccgctcgtccgtgcctacgccctggaaaaagcccttgacacgccggcacacatc
tacttcaagaacgaaagcgtgaatccgctgggttcgcacaaggtcaactctgccctcccg
cagtgctactactgcaagcaggaaagcgttacgaacgtcaccacggagaccggcgccggc
cagtggggggccgccctgtcctatgccgcgaaggtgttcgggctggaggcggctgtctac
caggtgaagatttccatgcagcagaagccttaccggtcgctgatcatgcgtgccttcggt
gcgatggtggaagggtcgccctccatgtcgacgcgtgccggcaaggacatcgtcacccgc
gaccccatgcacccaggctctttgggaaccgccatttccgaggccatcgagctggcccgg
acgactccccgctgcaaatacaccctcggttctgtcctgaaccacgtagccctacaccag
accatcatcggtctggaggccgagaagcagatgacgatggccggcgaatatcccgacaag
gtgattgcctgcttcggcggcggcagcaacttcggcggcatcgctttccctttcatgcgg
cacagtctccttgacggaagacatacggagttcatcgcagcagaacccgacagctgtccg
aagctgacgcgcggcaggttcgaatacgacttcggcgatgaggcgggttatacgccgctg
ctgccgatgtacaccctcgggcacgacttcaaaccggcgaacatccatgccggcgggctg
cgctaccacggtgccggtgtcattgtgagccagctcatcaaggacggctatatgcacggc
atggacatcccgcagctggagagcttcgaggccggtatcctcttctcccgcaccgagggc
atcatccccgctcccgagagctgccatgccatcgccgccaccatccgcgaggcgaagaaa
gcaaaagagagcggccggcaggaggttcttctcttctgcctttccgggcacggactgatc
gacatgatcgcctacgattcgtatatcaacggcgacctgcagaactataccctgtcggac
gaagacatcgtccggaatctccagactgtgccgaaagtgtag

DBGET integrated database retrieval system