KEGG   Prevotella denticola: HMPREF9137_0194Help
Entry
HMPREF9137_0194   CDS       T01459                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pdn  Prevotella denticola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF9137_0194
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF9137_0194
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF9137_0194
Enzymes [BR:pdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF9137_0194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(213325..214686)
Genome map
AA seq 453 aa AA seqDB search
MAHQKRYLLDEQDIPTQWYNIQADMPVKPLPPLHPVTHKPMKAEDLAEIFSMECSRQELD
TEHAWIDIPEEVLDMYRYYRSTPLVRAYALEKALDTPAHIYFKNESVNPLGSHKVNSALP
QCYYCKQESVTNVTTETGAGQWGAALSYAAKVFGLEAAVYQVKISMQQKPYRSLIMRAFG
AMVEGSPSMSTRAGKDIVTRDPMHPGSLGTAISEAIELARTTPRCKYTLGSVLNHVALHQ
TIIGLEAEKQMTMAGEYPDKVIACFGGGSNFGGIAFPFMRHSLLDGRHTEFIAAEPDSCP
KLTRGRFEYDFGDEAGYTPLLPMYTLGHDFKPANIHAGGLRYHGAGVIVSQLIKDGYMHG
MDIPQLESFEAGILFSRTEGIIPAPESCHAIAATIREAKKAKESGRQEVLLFCLSGHGLI
DMIAYDSYINGDLQNYTLSDEDIVRNLQTVPKV
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcacaccagaaaagatacctgctcgacgagcaggacattcccacacagtggtacaac
attcaggcggatatgccggtcaaaccgcttcctcccctccatcctgtcacccacaaaccc
atgaaagccgaggatcttgccgagatcttcagcatggaatgttcccgtcaggagcttgac
acggagcacgcatggattgacattccggaagaggtgctggatatgtaccggtattaccgt
tcgacaccgctcgtccgtgcctacgccctggaaaaagcccttgacacgccggcacacatc
tacttcaagaacgaaagcgtgaatccgctgggttcgcacaaggtcaactctgccctcccg
cagtgctactactgcaagcaggaaagcgttacgaacgtcaccacggagaccggcgccggc
cagtggggggccgccctgtcctatgccgcgaaggtgttcgggctggaggcggctgtctac
caggtgaagatttccatgcagcagaagccttaccggtcgctgatcatgcgtgccttcggt
gcgatggtggaagggtcgccctccatgtcgacgcgtgccggcaaggacatcgtcacccgc
gaccccatgcacccaggctctttgggaaccgccatttccgaggccatcgagctggcccgg
acgactccccgctgcaaatacaccctcggttctgtcctgaaccacgtagccctacaccag
accatcatcggtctggaggccgagaagcagatgacgatggccggcgaatatcccgacaag
gtgattgcctgcttcggcggcggcagcaacttcggcggcatcgctttccctttcatgcgg
cacagtctccttgacggaagacatacggagttcatcgcagcagaacccgacagctgtccg
aagctgacgcgcggcaggttcgaatacgacttcggcgatgaggcgggttatacgccgctg
ctgccgatgtacaccctcgggcacgacttcaaaccggcgaacatccatgccggcgggctg
cgctaccacggtgccggtgtcattgtgagccagctcatcaaggacggctatatgcacggc
atggacatcccgcagctggagagcttcgaggccggtatcctcttctcccgcaccgagggc
atcatccccgctcccgagagctgccatgccatcgccgccaccatccgcgaggcgaagaaa
gcaaaagagagcggccggcaggaggttcttctcttctgcctttccgggcacggactgatc
gacatgatcgcctacgattcgtatatcaacggcgacctgcagaactataccctgtcggac
gaagacatcgtccggaatctccagactgtgccgaaagtgtag

DBGET integrated database retrieval system