KEGG   Prevotella denticola: HMPREF9137_0340Help
Entry
HMPREF9137_0340   CDS       T01459                                 

Gene name
rnhA
Definition
ribonuclease H (EC:3.1.26.4)
Orthology
K03469  
ribonuclease HI [EC:3.1.26.4]
Organism
pdn  Prevotella denticola
Pathway
DNA replication
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    HMPREF9137_0340 (rnhA)
Enzymes [BR:pdn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     HMPREF9137_0340 (rnhA)
DNA replication proteins [BR:pdn03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     HMPREF9137_0340 (rnhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(382135..382593)
Genome map
AA seq 152 aa AA seqDB search
MRTDYKQRTGTQPSPVSEGRAAWAVDAACSGNPGPMEYRCIDLQTGQQVFHFGPVLGTNN
IGEFLAIVHALALMGRQGITDKVIYSDSYNAILWVNKKHCKTTLVRNAETEQLFQVIARA
EHWLKTHKVTTPVIKWETRQWGEIPADFGRKK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacagattacaagcaacggacaggtacgcagccttccccagtctcggagggacgg
gctgcctgggctgtcgatgccgcctgttccggcaaccccggaccgatggaataccggtgt
atcgacttgcagaccgggcagcaggtgtttcatttcggccccgtgctggggacgaacaac
atcggagagttccttgccatcgtccacgccttggccttgatggggcggcagggaataaca
gacaaggtcatctacagcgattcctacaatgccatcctgtgggtgaacaagaagcattgc
aagacgacacttgtccgcaatgcggagaccgaacagctctttcaggtcatcgcccgtgcc
gagcattggctcaagacccataaggtcacgacacctgtcatcaaatgggagacaaggcag
tggggcgagattccggccgactttggccggaagaagtaa

DBGET integrated database retrieval system