KEGG   Prevotella denticola: HMPREF9137_0340Help
Entry
HMPREF9137_0340   CDS       T01459                                 

Gene name
rnhA
Definition
ribonuclease H (EC:3.1.26.4)
Orthology
K03469  
ribonuclease HI [EC:3.1.26.4]
Organism
pdn  Prevotella denticola
Pathway
DNA replication
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:pdn03030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(382135..382593)
Genome map
AA seq 152 aa AA seqDB search
MRTDYKQRTGTQPSPVSEGRAAWAVDAACSGNPGPMEYRCIDLQTGQQVFHFGPVLGTNN
IGEFLAIVHALALMGRQGITDKVIYSDSYNAILWVNKKHCKTTLVRNAETEQLFQVIARA
EHWLKTHKVTTPVIKWETRQWGEIPADFGRKK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacagattacaagcaacggacaggtacgcagccttccccagtctcggagggacgg
gctgcctgggctgtcgatgccgcctgttccggcaaccccggaccgatggaataccggtgt
atcgacttgcagaccgggcagcaggtgtttcatttcggccccgtgctggggacgaacaac
atcggagagttccttgccatcgtccacgccttggccttgatggggcggcagggaataaca
gacaaggtcatctacagcgattcctacaatgccatcctgtgggtgaacaagaagcattgc
aagacgacacttgtccgcaatgcggagaccgaacagctctttcaggtcatcgcccgtgcc
gagcattggctcaagacccataaggtcacgacacctgtcatcaaatgggagacaaggcag
tggggcgagattccggccgactttggccggaagaagtaa

DBGET integrated database retrieval system