KEGG   Prevotella denticola: HMPREF9137_0507Help
Entry
HMPREF9137_0507   CDS       T01459                                 

Definition
cytochrome C oxidase subunit II, periplasmic domain-containing protein
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
pdn  Prevotella denticola
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    HMPREF9137_0507
Enzymes [BR:pdn01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     HMPREF9137_0507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(578103..580151)
Genome map
AA seq 682 aa AA seqDB search
MIFIMKKSILFSLASLIAFGGVLHSCKPKKTGQIAVDDDAAKQVYVAPGHYDEYYDFVSG
GFSGQVAVYGIPSGRLLKVIPVFSQNGENGYGYDENTKPMLNTSFGFVPWDDSHHTQLSE
TDAMYDGRWLFINANNTPRIARIDLKSFRTAEIIELPNTSGNHASPFITCNTEYIVAGTR
FSVPADYENGDVPIKDYKEKFRGHISYIKVDKNTGGLSLDFQLALPPFNYDLSHSGKNAS
ADWSFFTCYNTEEAHSLLEVNASHNDKDYILAINWKKAAEHAAKGDFDWKPCKYAHNVMH
EDTEQATSEILNKVKVIDTRKYNDFLYLIPCPKSPHGVDVDPSGEYIVGNGKLSANLPVF
SFTKIQDAIKNHQFDGKVDGINVIKYESALHGEVQSPGLGSLHTEFDADGNAYTSFFISS
EIVKWRLKDCQIEDRIPTYYSIGHLSVLGADTKKPYGKYMVAYNKITKDCFLPTGPELCQ
AAQLYDISGKKMRLILEFPTIGEPHYASAIAADMLKPNMMYFTRLADNHNPYKISTAQQA
RVERHGNRVDIYMAAIRSRLVPDNIEGIRLGDEVYFHVTNIEQEWDIPHGFTVKGNNNAE
ILVMPGETCTLKWIPNRVGILPFYCTDFCSALHQEMQGYARVSPKGSNTPLSFTIDDKLP
SQFAATKPTTQSAAAPTTHKRK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
ttgatcttcattatgaaaaagtctattctattttcgcttgcatcgctcattgccttcggc
ggtgtgctgcattcctgcaagcccaagaagaccgggcagattgcagtcgacgacgatgca
gccaagcaggtctacgttgctcccgggcactatgacgagtactacgacttcgtgtcggga
ggcttcagcggacaggtggctgtctatggcatcccgtccggccgcctgctcaaggtaatc
cccgtcttttcacagaacggtgaaaacggctatggctatgacgagaacaccaagcccatg
ctgaacacatccttcggattcgtgccatgggacgactcgcaccatacacagctttccgag
accgatgccatgtacgacggccgctggctgttcatcaatgccaacaacacgccgcgtatt
gcacgcatcgacctcaagagcttccgtacagcagaaatcatcgaactgccgaatacgagc
ggcaaccatgcttcgccgttcatcacctgcaacacagagtacatcgtggcaggtacccgc
ttcagcgtcccggccgactacgagaacggtgacgtgcccatcaaggactacaaggagaag
ttccgcggacacatttcttatataaaggtagacaagaacaccggcggtctcagcctggac
ttccagctggctctgccgccgttcaactacgacctgagccacagcggcaagaatgcctct
gccgactggtcgttcttcacctgctacaacaccgaggaggcccactcccttctggaggtc
aacgcttctcacaacgacaaggactacatcctcgccatcaactggaagaaggctgcggaa
cacgcagcaaagggcgacttcgactggaagccctgcaagtatgcgcacaacgtgatgcac
gaagacaccgagcaggccacttccgaaatcctgaacaaggtgaaggtgattgataccagg
aaatacaacgacttcctttatctcatcccatgtccgaagtctccgcatggcgtggacgtg
gacccgtccggcgagtacatcgtaggcaacggcaagctgagtgccaacctgcctgtattc
agcttcacgaagatacaggatgccatcaagaaccaccagttcgacggcaaggtcgacggc
atcaacgtcatcaagtatgaatctgccctgcacggtgaagtacagtcgccggggctggga
tcactccataccgagttcgatgctgacggaaacgcctataccagcttcttcatctcttcg
gagattgtgaaatggagactgaaagactgccagatagaagaccgcatccctacttattac
tccatcggccatctgtccgtactgggtgccgacaccaagaagccctacggaaagtacatg
gtagcctacaacaagattacgaaggactgcttcctgccgacgggtccggagctttgccag
gcagcacagctctatgacatcagcggaaagaaaatgcgtctgatcctggaattcccgacc
atcggcgaaccccactatgccagtgccatcgcagcagatatgctgaaaccgaacatgatg
tacttcacccgcctggccgacaaccacaatccttacaagataagcactgcccagcaggca
cgtgtggagcgtcacggcaaccgcgtggacatctacatggcagccatccgctcacgcctc
gttcccgacaacatcgagggcatcaggctgggtgacgaggtttatttccacgtgacgaac
atcgagcaggagtgggacataccgcacggcttcaccgtaaagggcaacaacaatgccgag
attctcgtcatgccgggtgagacctgcacgctgaaatggattccgaacagggtaggcatc
cttccgttctactgtaccgacttctgcagtgcgctccatcaggaaatgcagggatatgcc
cgcgtctctccgaagggcagcaacacaccgctgagcttcaccatcgacgacaagctgccg
tcacagttcgctgccacgaaaccgacgacccagtcggctgcagctcctacgacgcacaag
agaaaataa

DBGET integrated database retrieval system