KEGG   Prevotella denticola: HMPREF9137_0726Help
Entry
HMPREF9137_0726   CDS       T01459                                 

Definition
putative 4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pdn  Prevotella denticola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF9137_0726
Enzymes [BR:pdn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     HMPREF9137_0726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(865502..868195)
Genome map
AA seq 897 aa AA seqDB search
MNIQFHIDYKTYYGQDLVLNIITGQHNGAEEASQYRMRTADGYHWEVEVKKDTKPGTQMD
YFYSILRGDNEERREWGAMNHRLEFNAERGLNYQVYDHWSDLPEDAYLYTSALADCIVGK
KLTKARLNNYNKAVTLKVRAPQLGAADELYLTGAEPALGAWNVKKALKMVQHNINEWTLT
LDAAKLSGDQMEIKFFARSHDDDASPVWEYSNNRTLELPAMEEGETIVYELDEAFFPVPA
VRVAGTLVPVFSLRSEASFGIGDFGDLKKMIDWVCLTGQRALQILPINDTTITHTWTDSY
PYSCISVFALHPQYADLNALPALKDKKQREKFEALRKELNALPQIDYERVNDAKTEYLRL
LFEQEGGKVLESKAFKTFFAETESWLVPYAQYCCMRDKFGTADFSRWPDHRQWNEADRKA
LSDPKDAAYKEAAFFYYVQFVLSSQLKAVHEYAQAHRVILKGDIPIGVNRYGCDVWTEPR
YFNLNGQAGAPPDDFSVNGQNWGFPTYNWDEMIKDGCQWWVNRFRNMAKYFDAYRIDHVL
GFFRIWEIPVSSVHGLLGQFAPALGMSREEIEGYGLHWQEELFTEPFITDWVLDRIFREH
ADEVRQKYVEHVWGDRYKMRPAYDTQRKVEKAFAGKTSDTDVWIRDGLYALISDVLFVRD
HKDPNRFHPRISVQFDFIYESLYDSDKAVFNKLYNDYYYRRNNQFWYQEAMKKLPKLVNA
TRMLVCAEDLGMVPDCVAWVMNELRILSLEIQSMPKDPHVRFGHLGENPYRSVSTISTHD
MATLRQWWDEDWARTQDYFNSMLHRGGPAPHPLPGWLARDIVSRHLTSPSMLCILGIQDW
MSIDENLRLADPNAERINIPANPKHYWRYRMHVSIEDLMKNNAFNEQVTDLSNQAGR
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacagtttcacatcgactacaagacctactacggacaggaccttgtcctgaac
atcatcacaggtcagcacaacggggcggaagaggcctcacagtacagaatgcgtacggcc
gacggctaccactgggaggtggaagtgaagaaagacaccaagccgggcacacaaatggac
tatttctacagcatcctccgcggcgacaacgaggagcgaagggaatggggtgccatgaac
caccggctggaattcaacgctgaacgcggtctgaactatcaggtctacgaccactggagc
gacctcccggaggatgcctacctctacacctctgccctcgccgactgcattgtaggcaag
aaactgacaaaagcaagactcaacaattacaacaaggccgtcacactgaaggtacgtgcg
ccgcagttaggtgcggcggatgagctgtacctcacaggggcagaaccggcactgggcgca
tggaacgtaaagaaagccctgaagatggtgcagcacaacatcaacgagtggaccctcacg
ctggatgctgcaaagctctccggcgaccagatggaaataaaattcttcgccagaagccac
gatgacgatgcgagtccggtatgggagtacagcaacaaccgtacactggagctgcccgcc
atggaggaaggagaaaccatcgtctacgaactggacgaagcgttcttccccgtcccggcg
gtccgtgtggcaggaacactggtaccggtattctcactccgttcggaggcgagcttcggt
atcggcgacttcggcgacctgaagaagatgatcgactgggtatgtctgaccggacagcgt
gcgctgcagattctgccgatcaacgataccactatcacacacacatggacggactcctat
ccctacagctgcatctcggtcttcgccctgcatccgcagtatgccgacctcaacgcattg
ccggcactgaaagacaaaaagcagcgtgagaagttcgaggcactgcgcaaggaactcaac
gcactgccgcagattgactatgagcgtgtgaacgatgcgaagacggaatacctccggctg
ctctttgaacaggaaggcggcaaggtgcttgaaagcaaagccttcaagactttctttgcc
gaaacggagagctggcttgttccttacgcacagtactgctgcatgagagacaagttcggg
acagctgacttctcgcgatggcccgaccacaggcagtggaacgaggccgaccgcaaggct
ctgtccgaccccaaggacgctgcctataaggaagcggcgttcttctattacgtacagttc
gtgctgagcagccagctgaaggccgtccacgagtacgcacaggcacacagggtcattctg
aaaggcgacatccccatcggcgtgaaccgctacggctgtgacgtatggacggaacctcgc
tacttcaacctcaacggccaggcaggtgctccgcccgatgacttctccgtaaacggacag
aactggggatttcctacctacaactgggacgaaatgatcaaggacggctgccagtggtgg
gtcaaccgcttccggaacatggcaaagtatttcgatgcctaccgcatcgaccacgtactc
ggcttcttccgcatctgggaaattccggtcagctcggttcacggactgctcggacagttt
gcgccggctctcggcatgagccgtgaagagatagaagggtatgggctgcactggcaggag
gaactgttcacggagccgttcattaccgactgggtactcgaccgcatcttccgcgagcat
gcagacgaggtgcggcagaagtacgtggagcacgtatggggcgaccgttacaagatgcgc
ccggcgtatgacacacagcgcaaggtggagaaggcttttgcgggcaagacctcggacacg
gacgtatggattcgcgacggtctctacgccttgatcagcgatgtgctcttcgtacgcgac
cacaaggacccgaaccgcttccatccacgcatcagcgttcagttcgacttcatttacgaa
agcctctacgacagcgacaaggccgtgttcaacaaactctataacgactattactatcgc
cgcaacaaccagttctggtatcaggaggcgatgaagaaacttccgaagctggtgaatgcc
acccgtatgctggtctgtgccgaagacctcggaatggttcccgactgcgtggcatgggtg
atgaacgagctgcgcatcctcagtcttgaaatccagagcatgccgaaggatccgcatgta
cgcttcggtcacctgggagagaacccgtaccggagtgtcagcaccatctccacacacgac
atggcaacgctacgccaatggtgggatgaagactgggcacgcacgcaggactacttcaac
agcatgctgcaccgcggcggtccggcacctcacccgctgccgggatggctggcaagggac
attgtcagccggcacctgacatcgccgagcatgctctgcatcctcggcatacaggactgg
atgagtattgacgagaatctccgtttggcggatccgaacgccgaacgcatcaatatccct
gccaatccgaagcactactggcgctaccgtatgcacgtcagcattgaggacctgatgaag
aacaatgccttcaatgagcaggtgacagacctgagcaaccaggccggccgataa

DBGET integrated database retrieval system