KEGG   Prevotella denticola: HMPREF9137_0735Help
Entry
HMPREF9137_0735   CDS       T01459                                 

Definition
alpha amylase catalytic domain-containing protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
pdn  Prevotella denticola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF9137_0735
Enzymes [BR:pdn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     HMPREF9137_0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
882366..884381
Genome map
AA seq 671 aa AA seqDB search
MKRMLAGAFTLALSLCSMAQGVQGWPAGYGGVMLQGFYWDSFDDSQWTVLEKKADDFAGC
FDLVWVPQSGKAAASKSMGYDPLYYFNQNSSFGTEAELRSMIKTFKAKGIGTIADVVINH
HGTNSGWFGFPAEAYKGVTYQHQSTDVCANDDNGKAAAEARRTEVQLSTNDDEGEGWDGM
RDLDHKQANVQKIVKAYENYLLNDLGYAGFRYDMVKGFAGSHIGDYNTAANVKYSVGEYW
DGNANTVKSWIDATGKKSAAFDFAFRYTVRDAVNADDWRKLAGASGLTVEDGKYRQYAVT
FVENHDMQYRSASEPQDPIRRDTLAANAYLLAMPGTPCVFYAHYLAYPKEIKLMIAARKL
AGVTNTSSYLPYRSSKDYYANTVEGTNGKLLVVVGKGANQLSVPRGRYAKLLSGYHYAYY
LAREAETPWVDKASGAYEADNLKIKLTAVSAHADARLVYTTNGTTPTAGSTQVASDTEIT
IPEGETTLKVALLVNGVVGKVITRSYKVKRPVPFTPQTIRVYVNADKVGWNSYVNYHSWG
GTHKGTAWPGDRVTTAETKDGKKWYYKDYTLNNADDYVNFVFSIGTAATASDNQTLDVER
VKKTSYFEISSTKENGKFTVTDKTAAMGIDNVQAGRNVADSAYYTLSGQQLSARPVQRGI
YIHAGRKIVVR
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaatgttagcaggtgcatttactttggcactttctctctgttctatggcacag
ggggtacagggctggccggccggctacggcggtgtgatgctgcagggcttctactgggat
tcattcgacgactcccaatggacggtgttggagaagaaagccgacgatttcgccggctgc
ttcgaccttgtatgggtgccgcagagcggcaaggcggctgcatcgaagtcgatgggctat
gacccgctttattacttcaaccagaactcctcgttcggtacggaggcggagctccgcagc
atgataaaaactttcaaggcaaagggaatcggaaccatcgccgatgtcgtcatcaaccat
catggcacgaacagtggctggttcggcttccctgccgaggcctacaagggggtgacttat
cagcatcagtcaacggatgtctgcgccaacgacgacaatggcaaagcggccgctgaggcc
cgccgtacagaggtgcagctcagtacgaacgatgacgaaggagaaggatgggacggtatg
cgcgacctcgaccacaagcaagcgaacgtgcagaaaatcgtgaaggcatacgagaattac
ctgctcaacgatctcggttatgccggcttccgttatgacatggtgaagggctttgccggt
tcgcacatcggcgactataatacggctgccaacgtgaagtactctgtcggcgagtactgg
gacggcaatgccaatacggtgaagtcgtggatcgacgccaccggcaagaagagcgcagcc
ttcgacttcgccttccgctatacggtgcgtgatgccgtcaatgccgacgattggcggaag
ctcgcaggggcatcggggcttacggtcgaggatgggaagtaccggcagtatgccgtcacc
tttgtcgagaaccatgatatgcagtatcgttcggcttccgaacctcaggaccccatccgc
cgggacacgcttgccgcgaatgcctatctgctggcaatgccgggcacgccttgtgtgttc
tatgcccattacctggcttatccgaaggaaatcaagttgatgatcgccgcccgcaagctg
gctggcgtgacgaatacgagcagctatctgccctaccgttcctcgaaagactactatgca
aataccgtcgagggaacgaacggcaagctgctggtggttgtcggcaagggagccaaccag
ttgtctgtaccccggggacgttatgcaaagctgctcagcggctatcactatgcttactat
ctcgcccgtgaggcagagactccatgggttgacaaggcaagcggtgcgtatgaagcggat
aatttgaagataaagctgacggctgtatcagctcatgcggatgccaggcttgtttataca
acgaacggtacgacacccacggcaggcagcacacaggtagcttcagatacagagataacc
atccccgagggtgagacgaccttgaaagtggcactgctcgtcaatggagttgtgggcaag
gttattacccgctcctacaaggtgaaacgccccgtaccgttcacgccgcagaccatccgg
gtctatgtgaatgccgataaggtgggctggaacagctacgtgaactatcactcctggggc
ggcacgcacaagggtacggcgtggccgggcgaccgtgtgacgacagcggaaaccaaagac
ggaaagaaatggtactataaggactataccctcaacaatgcagacgactacgtgaacttc
gtgttcagcatcggaacagcagctactgcgagcgacaaccagacgctggatgtcgagcgg
gtgaagaagacctcctactttgaaatctcctcaacgaaggagaacgggaagtttacggtt
actgacaagacggctgccatgggcattgacaatgtgcaggctggtaggaatgtggcagac
agcgcttattatacgctctccggccagcagctctccgcccgtccggtgcagcgcggcatt
tatatccatgccgggcggaagatagtcgtccggtag

DBGET integrated database retrieval system