KEGG   Prevotella denticola: HMPREF9137_0833Help
Entry
HMPREF9137_0833   CDS       T01459                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pdn  Prevotella denticola
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pdn00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pdn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1000082..1001395
Genome map
AA seq 437 aa AA seqDB search
MESFIIEGGHRLSGTIAPQGAKNEALEVICATLLTTEEVIIRNVPDILDVNNLIKLLQDI
GVKVRKLAPNDFSFQADDVNLDYLESTGFVKKCSSLRGSVLMIGPLLGRFGKATIAKPGG
DKIGRRRLDTHFLGFKNLGAHFGRVENRDVYEIQADRLVGTYMLLDEASVTGTANIIMAA
VLAEGTTTIYNAACEPYIQQLCHLLNAMGAKISGIASNLITIEGVKTLHGAEHRILPDMI
EVGSFVGMAAMVGDGVRIKDVSIPNLGPILDTFRRLGVQIIEDEDDLIIPRQDHYVIDSF
IDGTIMTISDAPWPGLTPDLISVLLVVATQAQGSVLFHQKMFESRLFFVDKLIDMGAQII
LCDPHRAVVVGHDNGRKLRAGRMSSPDIRAGIALLIAALTAEGTSRIDNIAQIDRGYENI
EARLNALGAKIRRAEIC
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggaatcctttatcattgaaggtggacatcggctgagtggcacgattgccccgcaaggt
gcgaagaatgaagccttggaagtcatttgtgcaaccctgttgacgacggaagaggtcatc
atccgtaatgttccagacatccttgatgtgaacaacctcatcaaactgctgcaggacatc
ggcgtgaaggtgagaaagctcgctccgaacgacttctctttccaggcagacgatgtgaac
cttgactatctggagagtaccggcttcgtgaagaaatgctcgtccctgcgtggcagcgta
ctgatgattggtccgctgttaggtcgcttcggcaaggcgacgatagccaagccggggggg
gacaaaatcggccgccgccgtctcgatacgcatttcctgggtttcaagaacctcggggca
cacttcggacgtgtcgagaaccgtgatgtctacgagatacaggccgaccgccttgtcggc
acttatatgctgctggacgaggcatcggtgacgggtacggccaacatcatcatggctgcc
gtgctggcggaggggacaacgacgatatacaatgctgcctgcgaaccgtatatccagcag
ctctgccacctgctcaatgcgatgggtgcaaaaatcagcggtatagccagcaacctgatt
accatagagggtgtgaagacgctgcatggggcagaacaccggattctcccggatatgata
gaagtcggctcgtttgtcgggatggcagctatggtgggagacggcgtacgaatcaaggat
gtatcgattcccaacctcggcccgattctcgataccttccgccggctgggcgtgcagatc
attgaggatgaagatgacctcatcattccccgccaggaccattacgtgatagattccttt
attgacggaacaattatgaccatcagcgatgcgccctggccgggactgacaccggacctc
atctccgtgctcctcgttgtggcgacgcaggcgcagggcagcgtgcttttccatcagaaa
atgtttgagagccggctgttcttcgtcgacaaactcatcgacatgggggcgcagattatt
ctctgtgaccctcaccgcgccgtagttgtcggacacgacaacggcaggaaactccgcgcc
ggacgtatgtcaagtcctgacatccgcgccggcatcgccttgcttattgcagccttgaca
gcggaaggcacgagccgtattgacaacatcgcacagattgaccgcggttacgagaacatc
gaggcacgcctgaacgcattgggggcaaagatccgcagagccgaaatatgttag

DBGET integrated database retrieval system