KEGG   Prevotella denticola: HMPREF9137_0835Help
Entry
HMPREF9137_0835   CDS       T01459                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pdn  Prevotella denticola
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF9137_0835 (dxr)
Enzymes [BR:pdn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HMPREF9137_0835 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1002124..1003281
Genome map
AA seq 385 aa AA seqDB search
MKQQICILGSTGSIGTQALDVISQHPDLYEPYALTANRRWKELAAQARRFHPAAVVIADE
TFYEPLVKELADMPDVKVYCGSKALEEIVESPSIDMVLTAMVGYAGLAPTIHAVKAKKRI
CLANKETLVVAGELILQLAQQYHTPILPVDSEHSAIFQSLVGEDGNEIEKILLTCSGGPF
RRFTHDQLKTVTAADALKHPTWDMGAKITIDSASLMNKGFEVIEAKWLFGVPADKIQVLV
HPQSIVHSAVQFRDGGVKAQLGVPDMRLPIQYAFSFPKRLHLNGDRLDLFRQPLEFFEPD
VEKFKCLAMAYEAINKGGNMPCIVNAANEIVNAGFRCGLCSFLAMGDIIEQTMQQVAFDS
NPDYEVYVQTDAEARRVAQDIMNNQ
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacaaatctgtatattaggttcgacgggcagcatcggtacgcaggcactggat
gtaatcagccagcaccccgacctttatgagccttatgcactcacggccaaccgccgttgg
aaagagcttgctgctcaggcacgccgtttccatcccgccgccgtggtcattgccgacgag
actttctatgaacctctggtaaaagaactggccgatatgcccgatgtaaaggtgtattgt
ggcagcaaggcattggaagagatcgtcgagtccccctccattgacatggtgctgacggcg
atggtgggctatgccggtcttgctccgaccatccatgccgtcaaggcgaagaagagaatc
tgccttgccaacaaggagacgcttgtcgttgccggtgagctgattcttcagctggcacag
cagtatcatacgcctatcctgccggttgacagcgagcacagtgccatcttccagagcctt
gtcggcgaggacggcaacgagattgagaagattctgctcacctgttcgggcggtcctttc
cgcaggtttacgcacgatcagctgaagacggtcactgccgctgatgccctgaagcatcca
acatgggatatgggggccaagataaccatcgactccgcatcgctgatgaacaagggcttt
gaggtgatagaggcgaagtggctcttcggtgtaccggccgataagatacaggtactcgtc
catccgcagtctatcgtccacagtgcggtgcagttccgtgacggtggtgtgaaggcgcag
ctgggggttcctgatatgcggttgcccatccagtatgctttctcgttcccgaaacggctg
catctgaacggcgaccgtctcgacctgttccgccagccgctggagttcttcgagccggat
gtggagaagttcaagtgccttgccatggcttacgaggcaatcaacaagggcggaaatatg
ccgtgcattgtcaatgcggccaacgaaatagtcaatgcgggcttccggtgtggcttgtgc
tcgttcctcgccatgggcgacatcatcgagcagaccatgcagcaggttgccttcgacagc
aatcccgactatgaggtttacgtgcagacggatgccgaggcacgccgtgtggcacaggat
attatgaataatcaataa

DBGET integrated database retrieval system