KEGG   Prevotella denticola: HMPREF9137_0962Help
Entry
HMPREF9137_0962   CDS       T01459                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pdn  Prevotella denticola
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pdn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1122946..1123554
Genome map
AA seq 202 aa AA seqDB search
MQQYPSQLLERAVEAFSQLPGVGRKTALRLVLHLLRQPADEVDGFAEAVVRVKHDVKYCK
VCHNISDSDVCSICSDPRRDASLVCVVENIQDVMAIENTQQFHGLYHVLGGIISPMDGVG
PHDLEIDSLVKRVDEGGVKEVILALASTMEGDTTNFYLSRKLKGKNVKLSVIARGISVGD
ELEYTDEVTLGRSILNRTPFES
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatatccttcccagctcctggaacgtgccgttgaggccttctcccaattgccg
ggcgtgggacggaagaccgccctgcgccttgttcttcatctgctccgtcagccggccgat
gaggtggatggctttgccgaagccgttgtacgggtgaaacacgatgtgaaatactgcaag
gtgtgtcataacatctcggactctgatgtctgttccatctgttccgacccgaggcgggat
gcttcgctggtctgcgtggtggagaacatacaggacgtgatggccattgagaatacccag
cagttccacggactgtaccacgtgctgggcggcatcatctcgccgatggacggtgtcgga
ccgcacgacctcgagattgattcgctcgtgaaacgtgtggacgagggaggcgtgaaggag
gtgattcttgcccttgccagcacgatggagggtgataccaccaacttctatctctcgcgg
aagctgaagggaaagaacgtgaaactatcggtcatcgcacggggcatatccgtcggcgat
gaactcgagtatacggacgaggtgacgctgggcagaagcattctgaaccgtacgcctttt
gaaagctga

DBGET integrated database retrieval system