KEGG   Prevotella denticola: HMPREF9137_1011Help
Entry
HMPREF9137_1011   CDS       T01459                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pdn  Prevotella denticola
Pathway
pdn00010  Glycolysis / Gluconeogenesis
pdn00030  Pentose phosphate pathway
pdn00051  Fructose and mannose metabolism
pdn00052  Galactose metabolism
pdn00680  Methane metabolism
pdn01100  Metabolic pathways
pdn01110  Biosynthesis of secondary metabolites
pdn01120  Microbial metabolism in diverse environments
pdn01130  Biosynthesis of antibiotics
pdn01200  Carbon metabolism
pdn01230  Biosynthesis of amino acids
pdn03018  RNA degradation
Module
pdn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9137_1011 (pfkA)
   00030 Pentose phosphate pathway
    HMPREF9137_1011 (pfkA)
   00051 Fructose and mannose metabolism
    HMPREF9137_1011 (pfkA)
   00052 Galactose metabolism
    HMPREF9137_1011 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    HMPREF9137_1011 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HMPREF9137_1011 (pfkA)
Enzymes [BR:pdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HMPREF9137_1011 (pfkA)
Protein phosphatases and associated proteins [BR:pdn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HMPREF9137_1011 (pfkA)
Messenger RNA biogenesis [BR:pdn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HMPREF9137_1011 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Phage_min_cap2 NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEA20665
UniProt: F2KY91
Position
1189109..1190086
Genome map
AA seq 325 aa AA seqDB search
MAKIKTIGILTSGGDAPGMNAAIRAVTRAGIYNGFDIKAVYRGYDGLITNDIRPFTTENV
SGIIGQGGTILKTARSKEFATEEGRKKAYDNLVAAGIDALVVIGGNGSLTGAMKIAQEFD
ICCIGLPGTIDNDLYGTDNTIGYDTTMNTIVECVDRIRDTAQSHERIFFVEVMGRDAGFL
AQNSAIASGAEAAIIPEDSTDVDQLARFMERGIRKSKRSCIVIVSESPKCGAMYYADRVR
KEFPDYDVRVSILGHLQRGGRPSARDRILASRTGVGAVEAIMQGQRNIMVGVRNNEVVYV
PLSEAIRSDKPFDRKLIKVLDELSI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaataaagacaatcggtattttgacttccggtggtgatgcaccgggtatgaat
gcggccatccgtgctgtgacaagagcgggtatctacaacggtttcgatataaaggcggtc
tatcgcggctatgacggactgattacaaacgatatacgtccttttacaaccgagaatgtc
agtgggattatcggccagggcggaaccatcctgaagacggcgcgctctaaggaattcgct
acggaagaaggcaggaagaaagcctatgacaaccttgttgccgcaggcattgatgcactg
gttgtcattggtggaaacggatcgctgacaggtgccatgaaaatcgcacaggaatttgac
atctgctgtatcggcctgcccggcaccatcgacaacgatctttatgggacggacaatact
atcggctatgatacgacgatgaacaccatagtggagtgtgtcgaccggatccgtgatact
gcacagagccacgagcgcatcttctttgtcgaagtgatgggacgtgatgcgggatttctc
gcccagaactcggccattgccagcggagccgaggcggccattatcccggaggattcgacg
gatgtggaccagctggcacgtttcatggaacgcggcatccgtaaatcgaagcggagctgt
atcgtcatcgtgtcagagagtcccaaatgcggggcgatgtattatgccgaccgtgtgcgc
aaggaatttcccgactatgatgtgcgtgtctccatcctggggcacttgcagaggggcgga
cgcccgtcggcacgcgaccgcatcctggcaagccgtacgggagtgggggccgtcgaggcc
attatgcagggacagcgcaacatcatggtaggcgtgaggaacaatgaagtcgtctacgtg
cccctgtcagaggcgatccgttcagacaagcctttcgacaggaaactcatcaaggtactc
gacgagctgagcatctga

DBGET integrated database retrieval system