KEGG   Prevotella denticola: HMPREF9137_1011Help
Entry
HMPREF9137_1011   CDS       T01459                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pdn  Prevotella denticola
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:pdn01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pdn01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pdn00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pdn00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pdn00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pdn00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:pdn00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1189109..1190086
Genome map
AA seq 325 aa AA seqDB search
MAKIKTIGILTSGGDAPGMNAAIRAVTRAGIYNGFDIKAVYRGYDGLITNDIRPFTTENV
SGIIGQGGTILKTARSKEFATEEGRKKAYDNLVAAGIDALVVIGGNGSLTGAMKIAQEFD
ICCIGLPGTIDNDLYGTDNTIGYDTTMNTIVECVDRIRDTAQSHERIFFVEVMGRDAGFL
AQNSAIASGAEAAIIPEDSTDVDQLARFMERGIRKSKRSCIVIVSESPKCGAMYYADRVR
KEFPDYDVRVSILGHLQRGGRPSARDRILASRTGVGAVEAIMQGQRNIMVGVRNNEVVYV
PLSEAIRSDKPFDRKLIKVLDELSI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaataaagacaatcggtattttgacttccggtggtgatgcaccgggtatgaat
gcggccatccgtgctgtgacaagagcgggtatctacaacggtttcgatataaaggcggtc
tatcgcggctatgacggactgattacaaacgatatacgtccttttacaaccgagaatgtc
agtgggattatcggccagggcggaaccatcctgaagacggcgcgctctaaggaattcgct
acggaagaaggcaggaagaaagcctatgacaaccttgttgccgcaggcattgatgcactg
gttgtcattggtggaaacggatcgctgacaggtgccatgaaaatcgcacaggaatttgac
atctgctgtatcggcctgcccggcaccatcgacaacgatctttatgggacggacaatact
atcggctatgatacgacgatgaacaccatagtggagtgtgtcgaccggatccgtgatact
gcacagagccacgagcgcatcttctttgtcgaagtgatgggacgtgatgcgggatttctc
gcccagaactcggccattgccagcggagccgaggcggccattatcccggaggattcgacg
gatgtggaccagctggcacgtttcatggaacgcggcatccgtaaatcgaagcggagctgt
atcgtcatcgtgtcagagagtcccaaatgcggggcgatgtattatgccgaccgtgtgcgc
aaggaatttcccgactatgatgtgcgtgtctccatcctggggcacttgcagaggggcgga
cgcccgtcggcacgcgaccgcatcctggcaagccgtacgggagtgggggccgtcgaggcc
attatgcagggacagcgcaacatcatggtaggcgtgaggaacaatgaagtcgtctacgtg
cccctgtcagaggcgatccgttcagacaagcctttcgacaggaaactcatcaaggtactc
gacgagctgagcatctga

DBGET integrated database retrieval system