KEGG   Prevotella denticola: HMPREF9137_1030Help
Entry
HMPREF9137_1030   CDS       T01459                                 

Definition
firmicute fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
pdn  Prevotella denticola
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pdn01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pdn00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pdn00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pdn00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:pdn00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1210620..1212632)
Genome map
AA seq 670 aa AA seqDB search
MTNKHYNLKKDERYLQLLAKSFPNIADATTEIINLEAIAHLPKGTEHFLADIHGEYQAFQ
HVLKNASGNIKRKVNELFGDTLRSTEKRELCTLIYYPEQKLELVKHEEKDIKDWYHITIY
RLVEVCRDVSSKYTRSKVRKSLPADFSYIIQELLHEHSDDKDKTDYVSAIIKTIISTGRA
DDFITAICEVIQRLAIDQLHILGDVYDRGPGAHIVMDTLQNYHTWDITWGNHDILWMGAC
AGNDACICNVIRIALRYANMATIEDGYGINLIQLATFAMDVYGNDPCEEFMPKVSKDNPL
DDRNMTLTAQMHKAISIIQFKIESQMISRHPLWKMDDRRLLHAVDYKKGTIVVDGKEYKM
RSCNFPTINPEQPDQLTEEEQALIDRLHHSFTSSEKLRSHIQSLLRHGCMYNIVNHNLLY
HASIPLTKDGKLKEVEIAPGEKLKGKELLYQTGMKIRSAFQSNNDLQTEEEHQDAVDFFL
YLWCGPDSPLFDKAKMATFERYFLAEKETHKEEKGYYFSMRDNEQIVDMIMDEFHVPQPN
RHVINGHVPVHVVKGENPIKANGKLMVIDGGFSQAYHKETGIAGYTLVYHSRGFQLVQHE
PFTSAEDAIKRGTDIVSTTQIVEMNQHRLRVEDTDKGMELKLQIEALNELLYAYRCGFLT
EHERKTPPKA
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacaaacattacaatctgaagaaagacgagcggtatctgcagctgctggcaaaa
tcgttcccgaatattgccgatgccaccacggagattatcaaccttgaggccatcgcacac
ctcccgaaaggcacagagcacttccttgccgacatacacggtgaataccaggccttccaa
cacgtgctgaagaatgcctctggaaacatcaagcgaaaagtaaacgagctcttcggcgac
accctccgcagcacagagaagcgcgaactgtgtaccctgatctactatccggaacagaaa
ctggaactcgtcaaacacgaggaaaaggacataaaggactggtatcacatcaccatctac
cgtctggtagaggtgtgccgcgacgtgtccagtaaatacacccgctcgaaggtacgcaaa
tccttgccggcagatttctcctatatcatacaggagctgctgcacgaacattcggatgac
aaggacaagaccgactatgtgagcgccatcatcaagacgatcatctctaccggacgtgcc
gacgacttcattacggccatctgcgaagtcatacagcggctggccatcgaccagctgcac
attctgggcgatgtctacgaccgcggacctggtgcccacatcgtgatggacaccttgcag
aactaccacacatgggacatcacctgggggaaccacgacatcctgtggatgggagcctgt
gccggcaacgatgcttgcatctgcaacgtcatccgcatcgccctacgttatgccaacatg
gctaccatcgaagacggatacggcatcaacctcatccagctggccaccttcgccatggac
gtatacggcaatgacccctgtgaagagtttatgccgaaagtgtcgaaagacaacccgctt
gacgaccgcaacatgacgctgaccgcacagatgcacaaggccatcagcatcatacagttc
aagatagaatcgcagatgatcagccgtcatcctctatggaaaatggatgaccgccgcctg
ctccacgccgtcgactacaagaaaggaaccatcgtcgtggacggaaaagaatacaagatg
cgctcctgcaacttcccgaccatcaaccccgagcagcccgaccagctcaccgaggaggaa
caggcactcatcgaccggctgcaccattcgttcacatcaagcgaaaaactgcgcagccat
atccagtcgctgctccgccacggctgtatgtacaacatcgtcaaccacaacctgctctac
catgcctccatcccgcttacaaaagacggaaagctgaaagaggtggagatagcacccggg
gagaagctgaaagggaaggaactgctctaccagacaggcatgaagatccgttctgccttc
cagtcgaacaacgacctgcagaccgaggaagaacaccaggatgccgtcgacttcttcctc
tatctatggtgcggaccggacagtcccctcttcgacaaagccaagatggcgaccttcgaa
cgctatttccttgccgagaaggaaacccacaaggaagagaaaggctactatttcagtatg
cgcgacaacgaacagattgtcgacatgatcatggacgaattccatgtaccgcaacccaac
cgccacgtcatcaacggccatgttcccgtccatgtcgtcaagggcgagaaccctatcaag
gccaacggcaagctgatggtcatcgacgggggcttctcgcaggcctatcacaaggaaacc
ggaatagcaggctacaccctcgtctatcattcccgcggcttccagctcgtccagcacgag
ccgttcacgtcggctgaagatgccatcaaacgggggacagacattgtctcgacaacccag
atcgtagagatgaaccagcatcgcctccgcgtggaagacactgacaagggtatggaactg
aagctccagattgaagcgctcaacgaacttctctatgcctaccgctgcggtttcctcacc
gagcacgagcggaagacaccgcccaaggcataa

DBGET integrated database retrieval system