KEGG   Prevotella denticola: HMPREF9137_1057Help
Entry
HMPREF9137_1057   CDS       T01459                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pdn  Prevotella denticola
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HMPREF9137_1057 (folE)
Enzymes [BR:pdn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     HMPREF9137_1057 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1241289..1241882)
Genome map
AA seq 197 aa AA seqDB search
MTPETQFREGLDELAALYKKVLTLLGEDPEREGLEKTPMRVAKAMQVLTRGYTQDPHKVL
TDALFEEKYNQMVIVKDIDFFSMCEHHMIPFYGKAHVAYIPNGHITGLSKIARVVDIFSH
RLQVQERLTEQVMQCINDTLKPQGVMVVIEAKHMCMQMRGVEKQNAITTTSAYSGVFESS
KTRNEFMDLLRGETKRI
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgactccagaaacacagttccgtgagggtttagatgaacttgctgcactttacaaaaag
gtgctcacactcttaggtgaagaccctgaaagagaaggattggagaagactcctatgcgt
gttgccaaggctatgcaggtgctgacacgtggctatacgcaggatccacataaggtattg
actgatgcgctgtttgaagagaagtataaccaaatggtcattgtcaaggacatagacttc
ttctctatgtgcgaacaccacatgattcctttctatggaaaggcacatgtggcatatatc
ccgaacggacatatcactggattgagtaagattgcacgtgttgtggacatcttctcacat
cgcctgcaagtacaggaacgcctgacagagcaggttatgcagtgcatcaacgacacgctc
aagccacagggagtgatggttgtcatagaagcaaagcacatgtgtatgcagatgcgtggc
gtggaaaagcagaatgctattaccacaacaagtgcatatagcggtgtatttgaatcaagc
aagacacgtaatgagttcatggacttgctgcgtggagaaaccaagagaatataa

DBGET integrated database retrieval system