KEGG   Prevotella denticola: HMPREF9137_1091Help
Entry
HMPREF9137_1091   CDS       T01459                                 

Gene name
sucC
Definition
(RefSeq) succinate-CoA ligase subunit beta (EC:6.2.1.-)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pdn  Prevotella denticola
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF9137_1091 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HMPREF9137_1091 (sucC)
   00640 Propanoate metabolism
    HMPREF9137_1091 (sucC)
   00660 C5-Branched dibasic acid metabolism
    HMPREF9137_1091 (sucC)
Enzymes [BR:pdn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HMPREF9137_1091 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1288135..1289274)
Genome map
AA seq 379 aa AA seqDB search
MKVHEYQAKKFFASYGLPVDRNIVCKTPEEAVAAYKQLGVEKAVVKAQVHTGGRGKAGGV
KLGNNEAEIRQHAEAILGMNIKGFVVDRVLVSEAVDIASEYYMSILVDRKSKCPMLMLSR
AGGMDIEQVAKETPEKIEKIVIDPVVGMSDYLAREAAFKLFDNMAQVKQAVPIFKNIYRL
FTEKDASLAEINPLVMLKDGTLKAIDAKMTFDDNALFRHPDVAELFEPTAEERKEREAKD
KGFSYVNLGGSIGCMVNGAGLAMATMDMIKLYGGEPANFLDIGGSSNPEKIVEAMKLLLS
DGHVKVVLINIFGGITRCDDVANGLLEAFKVIKTDIPIVIRLTGTNEAEGRAILEGTHFT
VGTSMADAGHKAVELSKKL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtacatgaataccaggcaaagaaattctttgcaagttatggacttccggtggac
cgcaacatcgtttgcaagactcccgaagaagctgtggctgcctacaagcagttaggtgtt
gagaaagccgtggtgaaagcacaggttcacacgggtggacgagggaaagccggcggcgtg
aagctcggaaacaacgaagccgaaatccggcagcatgccgaagccatcctgggcatgaac
atcaagggttttgtcgttgacagagttctcgtcagcgaagctgttgacattgcatcggaa
tactacatgagtattctcgtcgaccgcaagtcaaagtgtccgatgctgatgctgagccgg
gcgggaggcatggacattgaacaagttgccaaggaaacaccggagaaaatagagaaaatc
gtcatcgaccccgttgtcggcatgagcgattaccttgcacgtgaggcggctttcaagctc
ttcgacaacatggcacaggtgaagcaggctgtacctatcttcaagaacatctatagacta
ttcaccgaaaaagatgcctctctggccgaaatcaacccgctggtcatgctgaaggacggc
acgctgaaagccatcgatgccaaaatgaccttcgacgacaatgccctcttccgccacccg
gacgttgccgagctcttcgaaccaaccgctgaagagcgcaaggagcgtgaagccaaggac
aagggattcagctacgtgaacctgggcggaagcatcggatgtatggtgaacggtgccgga
cttgccatggcgaccatggacatgatcaagctgtatggcggcgaaccggccaacttcctt
gacatcggcggcagttccaaccccgagaagattgtcgaggccatgaaacttctcctgagc
gacgggcacgtaaaggtggtgctgatcaatatcttcggcggtatcacacgctgcgacgac
gttgccaacgggctcctcgaggccttcaaggtaatcaagacagacattcctatcgtcatc
cgcctgacggggaccaacgaagccgaaggcagagccatcctcgaaggtactcactttacc
gtcggcaccagcatggccgatgcaggacacaaggcagtagaactgagcaaaaaactttaa

DBGET integrated database retrieval system