KEGG   Prevotella denticola: HMPREF9137_1124Help
Entry
HMPREF9137_1124   CDS       T01459                                 

Definition
peroxiredoxin HYR1 (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pdn  Prevotella denticola
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    HMPREF9137_1124
  Metabolism of other amino acids
   00480 Glutathione metabolism
    HMPREF9137_1124
Enzymes [BR:pdn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HMPREF9137_1124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1323616..1324164
Genome map
AA seq 182 aa AA seqDB search
MATVYDFNLKDKKGNEVSLGTYKGKVLLIVNTATGCGFTPQYEDLEAMYHSLKDKGLEIL
DIPCDQFGHQAPGTDEEIHEFCTMKFGADFPQFKKSNVNGADELPLYAWLKSQKGYAGGA
YEAKLAAVMEDLYNKANTEPRKQNDIQWNFTKFLVNRNGEVVARFEPTVDLKEVRKAVEA
EL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagtttacgatttcaatctgaaagacaagaaaggcaacgaggtaagtctcgga
acatacaaggggaaggtgctgctcatcgtcaatacggcaaccggctgcggcttcactccg
cagtatgaagacctggaggctatgtaccacagcctgaaggacaaggggctggaaatcctt
gacattccctgcgatcagttcggccatcaggctcccggtacggatgaggaaatccatgag
ttctgcacgatgaagttcggagcagacttcccgcagttcaagaagagcaatgtgaacggt
gctgatgaactcccgctctatgcgtggttgaagagccagaagggatatgccggcggtgct
tatgaggctaaactggcagccgttatggaagatctgtacaacaaggcgaacacggaaccc
cgcaagcagaacgacatccagtggaacttcactaagtttctcgtcaaccgcaatggtgag
gtcgtagcccgctttgagccgacagtcgacctcaaggaagtgcggaaggctgttgaggca
gaactctga

DBGET integrated database retrieval system