KEGG   Prevotella denticola: HMPREF9137_1315Help
Entry
HMPREF9137_1315   CDS       T01459                                 

Definition
(GenBank) alpha amylase, catalytic domain protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pdn  Prevotella denticola
Pathway
pdn00500  Starch and sucrose metabolism
pdn01100  Metabolic pathways
pdn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF9137_1315
Enzymes [BR:pdn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     HMPREF9137_1315
Exosome [BR:pdn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF9137_1315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: AEA21182
UniProt: F2KZR7
Position
1541247..1543340
Genome map
AA seq 697 aa AA seqDB search
MATKKTTTKKTPVRTPSARKTKVENTAEYTHVGLVKNDAYLAPYEDAIRGRHEHALWKMS
QLTQNGRQSLSDFANGYNYYGLHRTADGWVFREWTPNATAIYLVGDFNDWKETKSYLCHK
IEGTGNWELVLPPSAMQHGQFYKMRVHWTGGEGERIPAWAQRVVQDETSKIFSAQVWAPE
KPYVWKRKTFKPQTSPLLIYECHIGMAQDAEKVGSYNEFREKVLPRIIKDGYNAIQIMAI
QEHPYYGSFGYHVSSFFAASSRFGTPEELKALIDEAHRNGLAVIMDIVHSHAVKNEVEGL
GNLSGDPNQYFYPGDRHEHPAWDSLCFDYGKDEVLHFLLSNCKYWLEEYHFDGFRFDGVT
SMLYYSHGLGEAFCNYGDYFNGHEDDNAICYLTLANCLIHEVNKHALTIAEEVSGMPGLA
ARFEDGGYGFDYRMAMNIPDYWIKTIKELPDEAWKPSSIFWEIKNRRVDEKTISYCESHD
QALVGDKTIIFRLVDSDMYWHFRKGDETEMVHRGIALHKMIRLATAAAINGGYLNFMGNE
FGHPEWIDFPREGNGWSYKYARRQWNLVDNKELCYHYLGDFDREMLTVIKSEKNFNDTPV
QEIWHNDGDQILAFSRGELVFVFNFSPTRSYSDYGFLVPEGSYHVVLNTDARKFGGYGFA
DDTVEHLTNADPLYADQHKGWLKLYIPARSAVVLRKK
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaaagaagactacaaccaagaagactcctgtcaggacgccttctgccagaaag
acgaaagtagagaatacggcagagtacacccatgtcggactcgtaaagaatgatgcctac
ctggctccttatgaggatgcaatccgtggacgtcatgaacatgcactttggaagatgagc
cagctcacgcagaatggcagacagtcgctctctgacttcgcaaatggatacaactactat
gggttgcaccgtacagccgacggatgggtgttccgtgaatggacgcccaatgcaacggcc
atctatcttgtcggtgacttcaatgactggaaggagacgaaaagctatctttgccataag
atagaagggacaggcaactgggagcttgtgcttccgccctctgcaatgcagcacggtcag
ttctacaaaatgcgggttcattggaccggcggagaaggggagcgtattcctgcctgggcg
cagcgggttgtacaggacgaaacaagcaagattttctctgcacaggtatgggcaccggag
aaaccatacgtctggaagagaaagaccttcaagccccagacttcacccctgctgatttac
gagtgccatatcggcatggcgcaggatgcagaaaaagtcggttcttacaacgagttccgg
gagaaagtattgccgcgtatcatcaaggatggctacaatgccattcagattatggccata
caggaacatccctactatggaagttttggctatcatgtaagttccttctttgctgccagt
tcacgtttcggtacccccgaagagctgaaagccctgattgacgaggcgcacagaaacggt
cttgccgtcatcatggacattgtccactcccatgcggttaagaatgaggtagagggactg
ggcaatctgtccggcgaccccaaccagtacttctatccaggcgaccgtcatgagcatccg
gcctgggattcactctgctttgactatggaaaagatgaggttctccacttcctcctctcc
aactgcaaatactggctggaagagtatcatttcgacggtttccgctttgatggtgtcact
tctatgctttattacagccatggactgggagaggctttctgcaactatggtgattacttc
aacggacatgaagatgataatgccatctgctaccttactttggccaactgccttatccat
gaagtcaacaagcatgcgcttaccattgcagaagaggtgtcgggcatgcccggtctggct
gcccggtttgaggatggcggttatggcttcgactatcgtatggccatgaacatccctgac
tactggatcaagaccatcaaggaactgcccgatgaggcatggaagccgtcgtccatcttc
tgggaaatcaaaaaccgtcgtgtggacgagaagaccatctcttactgcgagtcgcatgac
caagcactggtgggcgacaagacaatcatcttccgtctggtggactcggatatgtactgg
cacttccggaagggagacgagacagaaatggtacaccgtggcatagccctgcacaagatg
atccgtcttgctacggcagcagccatcaacggcggttatctgaatttcatgggcaatgaa
ttcggacatccggagtggatcgacttcccgcgtgaaggcaatggatggagctataagtac
gcccgcagacagtggaatctggtggacaacaaggagctttgttatcattatcttggcgat
ttcgaccgtgaaatgctgacggtcatcaagagtgaaaagaacttcaacgatacgcctgtc
caggagatatggcataatgatggcgaccagattctggctttcagcagaggagagctggtc
ttcgtattcaacttctcaccgacacgttcttattcagattatggctttctggttccggaa
gggtcctatcatgtggtcctgaatactgacgccagaaaattcggtggctatggttttgcc
gatgatactgtcgagcacctgaccaatgccgatccgctctatgccgaccagcataaaggc
tggctgaaactctatattccggcccgcagtgctgttgtgctgagaaagaaataa

DBGET integrated database retrieval system