KEGG   Prevotella denticola: HMPREF9137_1347Help
Entry
HMPREF9137_1347   CDS       T01459                                 

Definition
putative glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pdn  Prevotella denticola
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF9137_1347
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9137_1347
   00052 Galactose metabolism
    HMPREF9137_1347
   00500 Starch and sucrose metabolism
    HMPREF9137_1347
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF9137_1347
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMPREF9137_1347
   00524 Butirosin and neomycin biosynthesis
    HMPREF9137_1347
Enzymes [BR:pdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HMPREF9137_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1585080..1586081
Genome map
AA seq 333 aa AA seqDB search
MDITEQTPVVTGLEKPFVIGLDLGGTNAVFGVVDQRGQVLATNSIKTQAYKTVDDFVEAG
VEALRPLIAKYGGISQFRAMGIGAPNGNFYRGTIEFAPNLSWGHDGVVPLGDMFSEKLEI
PVGLTNDANAAAIGEMQYGVARGMKDFIMITLGTGVGSGIVINGQMVYGSDGFAGELGHV
VMVRGEKGRSCGCGRTGCLEAYCSATGVARTAREFLKESDEDSLLRELKPAKITSLDVSI
AAGRGDALAKRVYEFTGEMLGEACADFATFSSPEAFIFFGGLTKAGDLLMQPIVRSYKEH
ALEIFKDKPKFLVSSLDDAAAAVLGASAIGWEL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggacataacagaacagacgccagttgttactggtttggaaaagccattcgtcattggc
ttggatttaggaggaacaaacgctgtgttcggggttgtcgaccagcgtggacaggtgctt
gcgaccaactcgataaagacgcaggcctacaagactgtcgatgattttgttgaagccggt
gtcgaagcactgagacctcttattgcgaaatacggcggtatcagccagttccgtgcgatg
ggtatcggtgcgcctaacggcaacttctaccgtggtacgattgagtttgcaccgaacctg
tcatggggtcacgacggcgtggtgccgttgggcgatatgttctcagagaaactggaaatc
ccggtaggtcttaccaatgacgctaatgctgctgccatcggtgagatgcagtacggcgtc
gcccgtggcatgaaagactttatcatgattaccctcggtaccggcgtcggctccggtatc
gtcatcaacggacagatggtgtatggttcagacggatttgccggtgagctggggcacgtt
gtaatggtccgtggagagaagggacgcagctgcggctgcggacgtaccggctgcctggag
gcttactgttccgcaacgggtgtcgcacgcacggcccgggagttcctgaaggaaagcgat
gaagattctttactgcgcgagctgaagcctgcgaagattacctctctggatgtctctatt
gccgcaggccgcggcgatgcactggccaaacgagtctatgaattcactggggaaatgctg
ggcgaggcctgtgctgattttgccaccttctcttctccagaggcatttatcttcttcggc
ggtctgacaaaagccggcgacctgttgatgcagcctattgtacgctcctataaggagcat
gctttggagatattcaaggacaaaccgaaattcctggtaagttcgctcgacgatgctgct
gcagctgtacttggtgcttcagccatcggttgggaactgtaa

DBGET integrated database retrieval system