KEGG   Prevotella denticola: HMPREF9137_1393Help
Entry
HMPREF9137_1393   CDS       T01459                                 

Definition
putative 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pdn  Prevotella denticola
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HMPREF9137_1393
Enzymes [BR:pdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HMPREF9137_1393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1634274..1634639)
Genome map
AA seq 121 aa AA seqDB search
MLNFAFSMKIIITLGSNTHQEENVSAAQILLRQCYKDISFSETRWTEPIGIESDKFLNCT
GTFETDLPPEKVKQQLKEIERKMGDSHENHQQGKVLIDIDLVQYDGKIVKGIIWLETSEK
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgcttaactttgcattctctatgaagataattatcacactcggctccaatactcatcag
gaggagaacgtatctgcggcacagatactgttgagacaatgttataaggacatcagcttc
tcggaaacacggtggacggaaccgattggaatagagtcggacaagttcctgaactgtaca
gggacattcgagaccgaccttccgcccgaaaaagtaaaacagcagctgaaggagatagaa
cggaaaatgggagattcacatgagaatcatcagcagggaaaggtattgattgatattgat
cttgtacaatatgatgggaaaatcgtaaaaggaataatatggctggaaacatcagaaaag
aaatag

DBGET integrated database retrieval system