KEGG   Prevotella denticola: HMPREF9137_1458Help
Entry
HMPREF9137_1458   CDS       T01459                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pdn  Prevotella denticola
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:pdn00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1699132..1699683
Genome map
AA seq 183 aa AA seqDB search
MKKMLLVVDPQIDFISGSLPVKGAAKAMDALAAYVKAHGDEYAVKIVTSDWHPYHHCSFA
DEGGQWPRHCVQHSAGAAIWEPLLVTLNESKGGFTLLYKGDSIQRDEYSIMQNEVSADVI
NRLVRALRIDQIDVCGLAGDICVLNTAEDLKRRGGNTRLNILEAYAPSLDGGSTLKAFIK
TLD
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatgttattggtagtcgatccgcagatcgactttatcagtggttcactccca
gtaaaaggcgctgccaaggcgatggatgcactggcagcgtatgtaaaggcgcatggtgat
gaatatgcagtaaagatagtcacttcagactggcatccctaccaccactgttcttttgcc
gatgagggtgggcaatggccgcgccactgtgtgcagcattctgcaggtgcggctatatgg
gagccgctgttggtgaccctcaatgagtcgaaaggaggttttaccttgttatataaaggc
gacagtatccagagggatgagtattccatcatgcagaatgaggtgtctgcagacgtaata
aaccggctggtccgtgcattgaggattgatcagattgatgtctgcggtctggcaggggac
atctgtgtactgaacaccgcagaagacctgaagcgtaggggcggaaatacacgtctgaac
atccttgaggcctatgctccgtcgcttgacggcgggtcgacgctgaaagcatttataaag
accttggactga

DBGET integrated database retrieval system