KEGG   Prevotella denticola: HMPREF9137_1458Help
Entry
HMPREF9137_1458   CDS       T01459                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pdn  Prevotella denticola
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    HMPREF9137_1458
Enzymes [BR:pdn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     HMPREF9137_1458
    3.5.1.-  
     HMPREF9137_1458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1699132..1699683
Genome map
AA seq 183 aa AA seqDB search
MKKMLLVVDPQIDFISGSLPVKGAAKAMDALAAYVKAHGDEYAVKIVTSDWHPYHHCSFA
DEGGQWPRHCVQHSAGAAIWEPLLVTLNESKGGFTLLYKGDSIQRDEYSIMQNEVSADVI
NRLVRALRIDQIDVCGLAGDICVLNTAEDLKRRGGNTRLNILEAYAPSLDGGSTLKAFIK
TLD
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatgttattggtagtcgatccgcagatcgactttatcagtggttcactccca
gtaaaaggcgctgccaaggcgatggatgcactggcagcgtatgtaaaggcgcatggtgat
gaatatgcagtaaagatagtcacttcagactggcatccctaccaccactgttcttttgcc
gatgagggtgggcaatggccgcgccactgtgtgcagcattctgcaggtgcggctatatgg
gagccgctgttggtgaccctcaatgagtcgaaaggaggttttaccttgttatataaaggc
gacagtatccagagggatgagtattccatcatgcagaatgaggtgtctgcagacgtaata
aaccggctggtccgtgcattgaggattgatcagattgatgtctgcggtctggcaggggac
atctgtgtactgaacaccgcagaagacctgaagcgtaggggcggaaatacacgtctgaac
atccttgaggcctatgctccgtcgcttgacggcgggtcgacgctgaaagcatttataaag
accttggactga

DBGET integrated database retrieval system