KEGG   Prevotella denticola: HMPREF9137_1785Help
Entry
HMPREF9137_1785   CDS       T01459                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pdn  Prevotella denticola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMPREF9137_1785 (ruvA)
Enzymes [BR:pdn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HMPREF9137_1785 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2059144..2059761
Genome map
AA seq 205 aa AA seqDB search
MIEYIRGELADLTPALAVVEAQGVGYALNISLNTYSAIQGRTPVKLYVHEAIMTGGRDDS
YTLYGFASRQERSLYRLLITVSGVGANIARMILSSLTPAELCNVIANGDEKMLKTVRGIG
LRTAQRIIVDLKDKIMQSGIADELHVSSQPGTPAVNTAIKDEAVSALTMLGFSPAPSAKV
VVSILTDQPDLPVEQVVKLALKMIK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatagaatacatcaggggcgaactcgctgacctgacacctgctttggcggtcgtcgag
gcacagggggtaggttatgcgctgaacatttcgctcaacacttatagtgccatacaaggc
aggacacctgtgaaactctatgtacacgaggcgatcatgaccggcggccgcgacgacagc
tacaccctctacggctttgccagcaggcaggaacggtcactctatcgtctgctgatcacc
gtctcgggtgtcggagccaacatcgcacgcatgatcctctcgtctctgacacctgcagaa
ctgtgcaacgtcattgccaatggggatgaaaagatgctgaagacggtcaggggcatcgga
ctgcgcacggcacagcgcatcatcgtcgacctgaaagacaagatcatgcagagcggtatc
gccgacgaactccacgtcagcagccaacccggtacgccggctgtcaacactgccatcaag
gacgaggccgtcagcgcactgaccatgctgggcttctcccctgccccatcggccaaagtc
gtcgtaagcatcctcaccgaccagcccgaccttcctgtggaacaggtcgtcaagctggcg
ttgaagatgataaagtaa

DBGET integrated database retrieval system