KEGG   Prevotella denticola: HMPREF9137_1884Help
Entry
HMPREF9137_1884   CDS       T01459                                 

Gene name
mro
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pdn  Prevotella denticola
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pdn00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pdn00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2184399..2185517
Genome map
AA seq 372 aa AA seqDB search
MVNSEETQYVCGMRKEDFQTTIDGRETDLYVLRNARGNEVAITNYGGAIVAIMVPDRDGN
LANVIQGHDNIQDVISSPEPYLSTLIGRYGNRIARGRFQLNGKEYRIAVNNGPNALHGGK
KGFNAKVWDAVQVNDHAVVLKYTSPYGEEGFTGEVEVWVAYSFTDDDELVIKYSAKTNKK
TVINLTSHGFFSLAGIADPTPSVENLECQINADFYLPIDETSIPTGEILKVAGTPFDFRT
PKPVGQDINADDEQIRIGAGYDHCFVLNKKEEGELSFAARIREPESGRTMEVYTTEPGVQ
VYTDNWADGYKGQHGATFPRRSAICFEAQHFPDSPNRPYFPSVVLEPGREYTQKTVYKFG
VEKQTTHVETNK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacagcgaagagacgcaatatgtctgcggcatgaggaaagaggatttccagacc
acgatagacggcagggagaccgacctctacgtactcagaaacgccaggggcaacgaagtt
gccatcaccaactacggcggggccatcgtcgccatcatggttcccgacagagacggcaat
ctggcgaacgtcatacagggacacgacaacatccaggacgtcatcagctccccggagcct
tatctctccaccctcatcggccgctacggcaaccgcattgccagaggacgcttccagctg
aacggcaaggaataccgcatcgctgtcaacaacggacccaacgcgctgcacggaggaaag
aaaggcttcaatgcaaaggtgtgggacgccgtccaggtaaacgaccatgccgtcgtactg
aagtacacgtctccctatggggaggaaggcttcaccggcgaggtggaagtatgggtagcc
tattcctttaccgacgacgacgagcttgtcatcaagtattcggcaaagaccaacaagaaa
accgtcatcaaccttaccagccacggattcttctccctggcaggcatcgccgaccctacc
ccgtcggtggaaaacctggaatgccagatcaacgccgacttctacctccccatcgacgag
acctccatcccgacaggcgaaatcctgaaggtggccggcacaccgttcgacttccgcaca
ccgaaaccggtcggacaggacatcaatgccgacgacgaacagataagaatcggcgcaggc
tacgaccactgcttcgtcctgaacaagaaggaggagggcgaactgtcgttcgcggcacgc
atcagagagccggagagcggcaggacaatggaggtctacaccaccgaaccgggcgtacag
gtatataccgacaactgggccgacggctacaaagggcagcacggggcgactttcccgcgc
cggagtgccatctgcttcgaggcgcagcacttccccgacagtcccaaccgcccttacttc
ccgtctgtcgtgctggagccgggcagggaatatacacagaagaccgtctataagttcggt
gtggagaaacagacaacccatgtagaaacaaacaaataa

DBGET integrated database retrieval system