KEGG   Prevotella denticola: HMPREF9137_2478Help
Entry
HMPREF9137_2478   CDS       T01459                                 

Gene name
ispE
Definition
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pdn  Prevotella denticola
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF9137_2478 (ispE)
Enzymes [BR:pdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HMPREF9137_2478 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2903162..2904067
Genome map
AA seq 301 aa AA seqDB search
MTAILQRFIIFAERILKTTFQTMITFPCCKINLGLNIVAKRPDGYHDLETVFYPIPLCDA
LEIKKMDEEFPSPTPVDLKVTGNSTGCDENENLVVKAYQIIAHDYALPRVHAHLVKRIPM
QAGLGGGSSDAAYMIRLLDERFRLNMGSAEMERYAARLGADCAFFIRSEIAYATGVGDIL
APVDDEDSNLEGYYLVLVKPDVAVSTAEAYEGITPRKPEKCCRDIVRQPIDTWRNELTND
FEESVFAKLPELGAVKNKLYDCGAIYAQMSGSGSTLFGIFGQKPSTIEEKFRGMFTYCVR
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaatattacaacgttttattatctttgcagaaagaattcttaaaacaacattt
cagactatgattacattcccttgctgcaaaatcaaccttggattaaacattgttgcaaaa
cggccggacggctaccacgaccttgaaacagtcttctaccccattcctctctgtgatgcc
ctcgaaataaagaagatggacgaggagttcccttctcctacgcctgttgacctcaaggtg
acgggcaattccaccggatgtgacgaaaacgagaatctggtggtaaaagcctatcagatc
atagcgcatgactatgcactcccacgtgtacatgcccaccttgtcaagcgtattcccatg
caggccggacttggcggcggctcatccgatgccgcctacatgatcagactgcttgacgaa
cgcttccggctgaacatgggtagtgccgagatggaacgttatgcagcccggctgggagct
gactgtgccttcttcatccgttcggagatcgcctatgcgacaggtgtcggagacatcctt
gcgcctgtggatgacgaggacagcaacctggaaggatattaccttgtgctggtaaaaccg
gatgtagccgtatcaacggccgaggcatacgaagggataacacccaggaaaccggaaaaa
tgctgccgggatatcgtacggcagcccattgacacctggcgcaatgagctgacaaacgac
ttcgaagaatctgtatttgctaaactccctgaactgggtgctgtgaagaacaaactgtac
gactgcggggcgatatacgcacagatgtctggcagcgggagcacactcttcggcatcttc
gggcagaagccttctaccatagaggagaaattccgtggaatgttcacctattgtgtcaga
ctataa

DBGET integrated database retrieval system