KEGG   Pseudomonas sp. ATCC 13867: H681_01265Help
Entry
H681_01265        CDS       T02524                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00860  Porphyrin and chlorophyll metabolism
pdr01100  Metabolic pathways
pdr01110  Biosynthesis of secondary metabolites
pdr01120  Microbial metabolism in diverse environments
Module
pdr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pdr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    H681_01265
Enzymes [BR:pdr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     H681_01265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 B12-binding
Motif
Other DBs
NCBI-ProteinID: AGI22135
UniProt: M4X9U5
Position
283426..284196
Genome map
AA seq 256 aa AA seqDB search
MSRWRLLLTRPEDECAALAASLAEVGIHSAGLPLLAIVAREESPAERSLILDLDRYCAVI
VVSKPAARLGLERLDRYWPQPPSNQGWFTVGAATAAILEDYGLAVHYPVDGDDSEALLKL
PALAQALQVHDPKVLILRGEGGREFLADCLRGQGVAVDYLELYRRELPAYPSGELLRRVR
EEHLNAVAISSGQGLEHLHRLAAQDWPQVSALPLFVPSPRVAEQARGLGAQRVIDCRGAS
AAALMEALRSADENNF
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgctggcggctgctgctgacccgtcccgaggatgagtgcgcggcgctggccgcg
agcctcgccgaggtagggatccacagcgccggcttgccgttgctggcgatcgttgcgcgg
gaagagtcgccggccgaacgcagcctgatccttgacctggaccgctactgcgcggttatc
gtggtcagcaagccggcggcgcgccttggccttgagcggctggatcgctactggccacag
ccgccgtcgaaccagggctggttcaccgtgggcgcggcgaccgcggctattctcgaggac
tacggcctggcagtgcattaccccgtggatggcgacgacagcgaagccctgttgaagctg
ccggcgttggcgcaggcgctgcaggtgcatgatccgaaggtgctgatcctgcgtggcgaa
ggtggccgagaatttctcgccgattgcctgcgcggccaaggcgtggcggtcgactatctg
gaactctaccgccgcgagttgccggcctatccctcgggggaactgctgaggcgggtccgc
gaggaacatctgaacgcggtggcgatcagcagcgggcaggggttggagcacctgcatcgt
ctggcggcgcaggactggccgcaggtgagtgcgctgccgctgttcgtgcccagtccgcgt
gtggccgagcaggcccgcgggctgggcgcgcagcgagtgatcgattgtcggggcgccagc
gctgcggcactgatggaggcgctgagaagcgctgacgagaacaatttctga

DBGET integrated database retrieval system