KEGG   Pseudomonas denitrificans: H681_05450Help
Entry
H681_05450        CDS       T02524                                 

Gene name
hisD
Definition
bifunctional histidinal dehydrogenase/histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pdr  Pseudomonas denitrificans
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pdr01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pdr00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1194448..1195767
Genome map
AA seq 439 aa AA seqDB search
MTAPFAIRRLNAADPDFARHLDHLLSWESVSDDAVNQRVLDIIADVRSRGDAAVVEFTQR
FDGVEAKAMSDLILPRERLELALTRITPAQREALETAANRVRSYHEKQKQDSWRYSEADG
TVLGQQVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVAEVVMVVPTPRGEINEIVLA
AACIAGVDRVFTIGGAQAVAALAYGTESVPQVDKIVGPGNIYVATAKRHVFGQVGIDMIA
GPSEILVVCDGGTDPDWIAMDLFSQAEHDEDAQSILVSPDAAFLDKVAASIEKLLPTMER
AEIILTSLSNRGALIHVADQEQACQVANRIAPEHLELSVADPESWLPKIRHAGAIFMGRY
TAEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIFCSAPGASELGKTASILARG
ESLTAHARSAEFRILEKGE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacccttcgctatccgtcgactcaacgccgccgatccggacttcgcgcgtcat
ctggaccatctgctctcctgggaaagcgtgtccgacgatgccgtgaaccagcgcgtgctg
gatatcatcgccgatgtgcgcagtcgtggtgacgcggcggtcgtggagttcacccagcgc
ttcgacggcgtcgaggcgaaagccatgtccgacctgatcctgccgcgcgagcgcctggag
ctggccctgacccgcatcaccccggcccagcgcgaggcgctggagacggccgccaatcgt
gtgcgcagctaccacgagaagcagaagcaggactcctggcgctacagcgaagccgacggc
accgtgctcggccagcaggtcaccccgctggaccgcgccggcctgtacgtgccgggcggc
aaggcgtcctacccgtcatccgtgctgatgaatgccatcccggccaaggttgccggcgtc
gccgaagtggtgatggtggtgccgactccgcgtggcgagatcaatgaaatcgtcctcgcc
gccgcctgcatcgccggtgtcgaccgcgtcttcaccatcggtggcgcccaggccgtggcc
gcgctggcctacggcaccgagagcgtgccgcaggtggacaagatcgtcggtccgggcaac
atctacgtcgccaccgccaagcgccacgtgttcggccaggtcggcatcgacatgatcgcc
ggtccctcggagatcctggtggtctgcgatggcggcaccgatccggactggatcgccatg
gacctgttctcccaggccgagcacgacgaagacgcccagtcgatcctggtcagcccggat
gcggcgttcctggataaagtcgccgccagcatcgagaaactgctgccgacgatggagcgc
gccgagatcatcctcacctcgctgagcaaccgcggcgcgctgatccacgtcgccgaccag
gagcaggcctgccaggtcgccaaccgtatcgccccggaacacctggagctgtcggtggcc
gacccggaaagctggctgccgaagatccgccacgccggggccatcttcatgggccgctac
accgccgaagccctgggcgactactgcgccgggccgaaccacgtgctgccgacttccggc
accgcgcgcttctcatcgccgctgggcgtgtatgacttccagaagcgatcctcgatcatc
ttctgctccgcgccgggcgcttccgagctgggcaagaccgcgtctatcctggcccgcggc
gagtccctcaccgctcacgcgcgcagcgccgagttccgaatcctggagaagggtgaataa

DBGET integrated database retrieval system