KEGG   Pseudomonas denitrificans: H681_13740Help
Entry
H681_13740        CDS       T02524                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pdr  Pseudomonas denitrificans
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    H681_13740
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    H681_13740
Enzymes [BR:pdr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     H681_13740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3101209..3102804
Genome map
AA seq 531 aa AA seqDB search
MSAYQNDIKAVAALKEKAGNSWSAINPESVARMRAQNRFKTGLDIAKYTAAIMRKDMAEY
DADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTNKRYLYLSGWMVAALRSDFGPLPDQSM
HEKTAVSGLIEELYTFLRQADARELDLLFTALDSARAAGDKAKQDEIQAQIDGYETHVVP
IIADIDAGFGNPEATYLLAKRMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKI
NAVRYAFLELGVDDGVIVARTDSLGAGLTKQIAVTKQPGDLGDQYNSFLDCDEISAAELQ
NGDVVINRGGKLLRPKRLASNLFQFRKGTGEDRCVLDCITSLQNGADLLWIETEKPHVGQ
IKGMVDRIREVIPNAKLVYNNSPSFNWTLNFRQQVFDAFVAEGKDVSAYDRAKLMSVEYD
ETELAQVADEKIRTFQRDGSAHAGIFHHLITLPTYHTAALSTDNLAKGYFADQGMLAYVK
GVQRQELRQGIACVKHQNMAGSDIGDNHKEYFAGEAALKASGKDNTMNQFH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcttatcaaaacgacatcaaagccgttgccgccctgaaagagaaagccggcaac
agctggagcgctatcaaccccgagtcggttgcccgcatgcgcgctcagaaccgcttcaag
actggtctggacatcgccaagtacactgcggccatcatgcgcaaggacatggccgagtat
gacgccgactcctccgtctatacccagtcgctgggttgctggcatggcttcatcggtcag
cagaagctgatctcgatcaagaagcacctgaagaccaccaacaagcgctacctctacctg
tccggctggatggttgccgcgctgcgttccgacttcggcccgctgcccgaccagtccatg
cacgagaaaaccgcagtatcgggcctgatcgaagagctctacacgttcctgcgccaggct
gacgcccgcgaactggatctgctcttcaccgccctggacagcgctcgcgccgctggcgac
aaggccaagcaggacgagatccaggctcagatcgacggctacgaaacccacgtcgtaccg
atcatcgccgatatcgacgccggcttcggcaacccggaagccacctacctgctggccaag
cgcatgatcgaagcaggcgcttgctgcatccagatcgaaaaccaggtttccgatgagaag
cagtgcggccaccaggacggtaaagtgaccgttccgcacgaagacttcctcgccaagatc
aatgctgttcgctacgccttcctcgagctgggcgttgacgatggcgtgatcgttgcccgc
accgactccctgggtgccggcctgaccaagcagatcgccgtgaccaagcagccgggcgac
ctgggcgaccagtacaactccttccttgactgcgacgagatcagcgccgccgagctgcag
aacggcgacgtggtaatcaaccgcggcggcaagctgctgcgtcccaagcgcctggcttcc
aacctgttccagttccgcaagggcaccggcgaagaccgttgcgtcctggactgcatcacc
tcgctgcagaacggcgccgacctgctgtggatcgaaaccgagaagccgcacgttggccag
atcaagggcatggttgaccgcatccgcgaagtcatcccgaacgccaagctggtttacaac
aacagcccgtccttcaactggaccctgaacttccgccagcaggtgttcgatgcgttcgtc
gccgaaggcaaggacgtttccgcctacgaccgcgccaagctgatgagcgtcgagtacgac
gagaccgaactggcccaggttgctgacgagaagatccgtaccttccagcgtgacggttcc
gcccacgccggcatcttccaccacctgatcaccctgccgacctaccacaccgccgcgctg
tccaccgacaacctggccaagggctacttcgccgaccagggcatgctggcctacgtgaag
ggtgttcagcgtcaggaattgcgtcagggcatcgcctgcgtcaagcaccagaacatggct
ggctcggacatcggcgacaaccacaaagagtacttcgctggcgaagccgctctgaaagcc
tcgggtaaagacaacaccatgaaccagttccactaa

DBGET integrated database retrieval system