KEGG   Pseudomonas denitrificans: H681_18640Help
Entry
H681_18640        CDS       T02524                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pdr  Pseudomonas denitrificans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4181552..4182280)
Genome map
AA seq 242 aa AA seqDB search
MRLSRLLAGAAFGLVSTLALAAEPDQAIRATLQSLQPDLPIEAIAKSPLEGIYQVQLKGG
RVLYASADGQFVVQGNIYQVKDGKPTNLTEEAESAGVAKTINGIPTADMVVFPAKGETKA
HITVFTDTTCPYCQKLHAEVPELQKRGIEVRYLAFPRQGPNSQGDQQLQAVWCSKDRQAA
MTDMFHEKEVKAAKCDNPVNKQLELGQMVGVQGTPAIILANGQMLPGYQPAGQIAKLALE
AK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgtcccgacttctggctggtgcggccttcggcctcgtcagcacccttgccctg
gccgccgagccggaccaggcaatccgcgccaccctgcaatccctgcagcccgacctgccc
atcgaagccatcgccaagagtcctctcgagggcatctatcaggtgcagctcaagggcggc
cgcgtgctctatgccagtgccgatggccagttcgtcgtccagggcaacatctaccaggtg
aaggacggcaagccgaccaacctgaccgaggaagccgaaagcgcgggcgtggccaagacc
atcaacggcatcccgaccgccgacatggtggtcttcccggccaagggcgagaccaaggcg
cacatcaccgtcttcaccgacaccacctgcccgtactgccagaagctgcatgccgaagtg
ccggaactgcagaagcgcggcatcgaagtgcgctacctggccttcccgcgccagggcccg
aactcgcagggtgaccagcagcttcaggccgtgtggtgctcgaaggatcgccaggcggcg
atgaccgacatgttccacgagaaggaagtgaaggccgccaagtgcgacaacccggtgaac
aagcagctggagctgggccagatggtcggcgtgcagggcaccccggcaatcatcctggcc
aatggccagatgctgccgggttaccagccggccggccagatcgccaagctggccctggag
gccaagtaa

DBGET integrated database retrieval system