KEGG   Pseudomonas denitrificans: H681_23300Help
Entry
H681_23300        CDS       T02524                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pdr  Pseudomonas denitrificans
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:pdr00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:pdr00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5220088..5220633
Genome map
AA seq 181 aa AA seqDB search
MKATPLTIPDVLVIEPQVFGDSRGFFFESYNQQKFEQAIARQIHFVQDNHSRSSRGVLRG
LHYQIQQPQGKLVRVVRGEVFDVAVDLRRSSPTFGQWVGQVLSEENKLQMWIPEGFAHGF
LVLSESAEFLYKTTDFWAPEHERCIAWNDPELAIDWPLDAEPALSGKDREGLRLAAAELF
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccaccccgttgactatccccgatgttctagtgatcgaacctcaagtcttcggt
gacagccgtggcttcttcttcgaaagctacaaccagcagaaattcgaacaggcgatcgcc
cgccagatccatttcgtgcaagacaatcactcgcgttcgtcccgcggcgtgctgcgcggg
ctgcactaccagatacagcagccccagggaaaactggtacgtgtcgtccgaggcgaggta
ttcgacgtcgccgtggacctgcgccgcagttcaccgaccttcggccagtgggtcggccag
gtcctcagcgaagagaacaagctgcagatgtggattcccgagggattcgcccacggtttc
ctggtgctcagcgaaagcgccgagtttctctacaagaccacggacttctgggcgccggag
catgagcgctgcatcgcctggaacgatccggagcttgccatcgactggcctctcgacgca
gagccggcgctgtccgggaaggaccgcgaagggctccgtctggcggctgccgaactcttc
gactga

DBGET integrated database retrieval system