KEGG   Pseudomonas sp. ATCC 13867: H681_24590Help
Entry
H681_24590        CDS       T02524                                 

Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00625  Chloroalkane and chloroalkene degradation
pdr00680  Methane metabolism
pdr01100  Metabolic pathways
pdr01120  Microbial metabolism in diverse environments
pdr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdr00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    H681_24590
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    H681_24590
Enzymes [BR:pdr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     H681_24590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD FAD_binding_2 FAD_binding_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AGI26785
UniProt: M4XNH8
Position
5516470..5517669
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGPGKVEVQNIPYPKMQDPQGKQIDHGVILRVVSTNICGSDQHMVRGRTTA
PEGLVLGHEITGEVVEIGRGVETMKIGDLVSVPFNVACGHCRTCKEQHTGVCLTVNPSRA
GGAYGYVDMGGWVGGQAEYVMVPYADFNLLRLPNRDAAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYIAGAGPVGLAAAASARLLGAAVVIVGDVNPTRLAHAKAQGFEIADLSRD
TPLHEQIADLLGEPEVDCAVDAVGFEARGHGHSGSQHEAPATVLNSLMGVVRVAGKIGIP
GLYVTEDPGAVDAAAKQGSLSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRIKIA
DVVGVEVITLDEAPKGYGEFDAGVPKKFVIDPHNLFRAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcaatcgtggtgtggtttatctcggcccgggcaaggtcgaggtacagaacatc
ccctatccgaagatgcaggacccgcagggcaagcagatcgaccacggggtgatcctgcgc
gtggtgtccaccaacatctgcggctccgaccagcacatggtccgtggccgtaccaccgct
cccgaaggcctggtactgggccacgagatcaccggcgaggtggtggagatcggtcgaggc
gtggaaaccatgaagatcggcgacctggtctcggtgccgttcaacgtcgcctgtggccac
tgccgcacctgcaaggagcagcacaccggcgtctgcctgacggtcaacccgtcccgcgcc
ggcggcgcctacggctacgtcgacatgggcggctgggtcggtggccaggccgagtacgtg
atggttccctacgccgacttcaacctgctgcgcctgcccaaccgcgacgcggcgatggag
aagatccgcgacctgacctgcctctccgatatcctgcccactggctaccacggagcggtg
acggccggcgtcggtccgggcagcaccgtctacatcgccggtgccggtccggtcggtctc
gccgctgccgcctcggcccgcctgctgggcgccgccgtggtgatagtcggtgacgtcaac
ccgacccgcctggcccacgccaaggcccagggcttcgaaatcgccgacctgtccagggac
accccgctgcacgagcagatcgccgacctgctgggcgagccggaagtggactgtgcggtc
gacgcggtgggcttcgaagcccgtggccacggtcattccggctcgcagcacgaggctccg
gccaccgtactgaactcgctgatgggtgtggtgcgggtcgccggcaagatcggcattccg
ggcctttacgtcaccgaggatccgggcgcggtggacgcggccgccaagcagggctcgctg
agcatccgcttcggcctcggctgggccaagtcgcacagcttccacaccggccagaccccg
gtgatgaagtacaaccgccagctgatgcaggcgatcatgtgggaccgcatcaagatcgcc
gatgtcgtcggggtggaagtcatcaccctggacgaagcgcccaaaggctatggcgagttc
gatgccggcgtgccgaagaaattcgtcatcgacccgcacaacctgttccgcgccgcctga

DBGET integrated database retrieval system