KEGG   Pseudomonas denitrificans: H681_24960Help
Entry
H681_24960        CDS       T02524                                 

Definition
class II aldolase/adducin domain protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pdr  Pseudomonas denitrificans
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pdr00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    H681_24960
Enzymes [BR:pdr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     H681_24960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5603506..5604288
Genome map
AA seq 260 aa AA seqDB search
MATTMHLPKNQLIQHAERQMQASLSDNTWTARQKLALTCRILFDGGHDSGLAGQITCRAE
QPGTYYTQRLGLGFDEISAGNLLLVDEDLKVLQGQGMANPANRFHSWVYRARPDVNCIIH
THPLHAAALSMLEVPLAVSHMDLCPLFDDCAFLKDWPGVPVGNEEGEIISAALGDKRAIL
LSHHGLLVTGSSIEEACVVAMLFERAAKMQLLAMAAGEIKPIPPALGKEAHDWISTPKRH
GAAFSYYARRSLREHGECLS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcaactaccatgcacctccccaagaaccagctgatccagcacgccgaacgacagatg
caggccagcctgtcggataatacgtggactgcccggcaaaaactggccctgacctgccgg
attctcttcgacggcggccacgactccggcctggccgggcagatcacctgtcgcgcggaa
cagcccggcacctactacacccagcgcctggggctgggcttcgacgagatttccgcaggc
aacctgctgctggtcgacgaagacctcaaggtgctccagggccagggcatggccaacccg
gccaaccgcttccacagctgggtgtaccgcgcccgcccggacgtcaactgcatcatccac
acccacccgctgcacgccgccgcgctgtcgatgctggaagtgccgctggcagtgtcgcac
atggacctctgcccgctgttcgacgactgcgccttcctcaaggactggccgggggtgccg
gtgggcaacgaggaaggcgagatcatctccgccgccctgggtgacaagcgcgccatcctg
ctctcccaccacggcctgctggtaaccggttcgagcatcgaggaagcctgcgtggtggcg
atgctgttcgagcgcgccgcgaagatgcagttgctggcgatggccgccggcgagatcaag
ccgattccgccggcgttgggcaaggaagcgcacgactggatttccacgcccaagcgccac
ggcgccgccttcagctactacgcccggcgcagcctgcgcgagcacggcgaatgcctgagc
tga

DBGET integrated database retrieval system