KEGG   Prevotella dentalis: Prede_0151Help
Entry
Prede_0151        CDS       T02403                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pdt  Prevotella dentalis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pdt01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pdt00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(204854..205948)
Genome map
AA seq 364 aa AA seqDB search
MGNERQKMKRIAVKVGSNVLTRDNGKLDVTRMSAIVDQIAWLRRNGYEVILISSGAVACG
RNELPVSHKLDGVEQRQLFSAIGQVKLIGLYYDLFREAGLHVGQVLTMKESFATRGEYLN
QRACMSVMLANGVIPIVNENDTVSVTELMFTDNDELSGLIAAMMDCNTLVILTNVDGIFN
GDPREANTRVIPSVNYDRDLREYIQDEKSGFGRGGMITKARIAGKVADEGIKVMIANGKT
DNILVDLATRPMETMHTEFRPNPNPTSTVKKWIAHSESFAKGVVRINAKATEALRGNKAV
SLLLVGVVGIEGDFEEGDIISIMDEDGRLVAVGRSGYSSAEAARHIGAHGMKPLVHYDYM
VMET
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgaacggcaaaagatgaaaagaatcgcagtcaaagtgggcagcaacgtgctc
acacgcgacaacggcaagctcgacgtgacacgtatgtcggccattgtagaccagatcgcc
tggctgcggcgtaacggatatgaggtgattctcatatcttcgggtgccgtggcctgcgga
cgcaatgagctgccagtgagccacaaactcgacggcgtggagcagcgacaactcttttca
gccatcggccaagtgaagctcatcggcctctattacgacctctttcgcgaggccggactc
catgtggggcaggtgcttaccatgaaagagagcttcgctacacgcggtgaatacctcaat
cagagggcgtgcatgagtgtgatgctggccaacggcgtcatcccgatagtcaatgaaaac
gacacggtgagcgtcacggagctgatgtttaccgacaacgacgagttgtctggactcatt
gcagccatgatggactgcaacacattggtcatcctgaccaacgtggacggcatctttaac
ggcgaccctcgcgaagcaaacacccgtgtcatcccgtccgtgaactacgaccgcgacctg
cgggaatacattcaagacgagaagagcggcttcggacggggcggcatgattacgaaagct
cgcattgccggaaaggttgccgacgaaggcatcaaggtgatgattgccaacggcaagacc
gacaacatcctcgtagacctggccacacgtcccatggagaccatgcacacggagttccgt
cccaaccccaaccccacctcgacggtgaagaaatggattgctcacagcgagagctttgcc
aagggtgtggtgcgaatcaatgccaaggccaccgaggctctgcgcggcaacaaggccgtg
agcctgctgctggtgggtgtcgtcggcatcgagggagactttgaagagggcgacatcatc
agcatcatggacgaggatggacggctggtggccgtggggcgcagcggctacagctccgcc
gaggccgcgcgccacatcggagcccacggcatgaaaccgctcgtgcactacgactatatg
gtgatggaaacttaa

DBGET integrated database retrieval system