KEGG   Prevotella dentalis: Prede_0640Help
Entry
Prede_0640        CDS       T02403                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pdt  Prevotella dentalis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pdt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(787778..788383)
Genome map
AA seq 201 aa AA seqDB search
MEQYPSALLEKAVEEFSRFPGIGRKTSLRLVLHLLRQPVERAEAFADAVQRVRKDIKYCR
VCHNISDTDVCPICSDARRDATTVCVVENVQDVMAVENTQQYDGLYHVLGGVISPMDGIG
PGDLQIDSLVKRVAQGEIKEVVLALSSTMEGDTTNFYISRQLKPYPVKLTVIARGISVGN
ELEYTDEVTLGRSILNRIPLS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggaacaatatccctccgctttactcgaaaaggctgtcgaagagttcagccgctttccg
ggcatagggcgcaagacctccttgcgccttgtgctccatctgttgcgccagcccgtggag
cgtgccgaggcctttgccgatgccgtgcagcgggtgcggaaagacattaagtattgtcgg
gtgtgccataacatcagtgatactgatgtgtgccccatctgctcggatgcccgacgcgac
gccaccaccgtgtgtgtggtggagaacgtgcaggatgtcatggccgtggagaacacacaa
cagtacgacggactttaccatgtgctgggtggagtcatctcgcctatggacggtattggt
cccggcgacctgcaaatcgactccctcgtcaagcgggtggcgcagggagaaatcaaggag
gtggtgttggctctcagctctaccatggagggcgacaccaccaatttctacatctcccgc
cagctcaagccctatcccgtcaagctgactgtcattgcccgcggcatttcggtgggcaac
gaacttgaatataccgacgaagtgacactgggccgttccattctgaaccgcatcccattg
tcctaa

DBGET integrated database retrieval system