KEGG   Prevotella dentalis: Prede_0757Help
Entry
Prede_0757        CDS       T02403                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pdt  Prevotella dentalis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pdt00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pdt00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:923590..924546
Genome map
AA seq 318 aa AA seqDB search
MEKHNFVTIADLSKEKILYLLDMAQEFERHPNRELLKGKVVATLFFEPSTRTQLSFQTAA
NRLGARVIGFSDAKTSSTTKGETLKDTILMVSNYADIIAMRHHIEGAAQYASEVVPIPII
NAGDGAHMHPSQCMLDLYSIYKTQGTLENLNIYLVGDLKYGRTVHSLITAMRHFNPTFHF
IAPEELAMPQEYKIYCKKHNIEFHEHTAFTEDEIAHADILYMTRVQKERFSDLMEYERVK
NVYILHESMLHKARPNMKIMHPLPRVNEIAYDVDNNPHAYYIQQAKNGLYAREAIFCYCL
GITLDDVRNDTTIIRSEY
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggagaagcataattttgtgacgattgccgatctgtccaaggagaagattctatacctg
ctcgacatggcgcaagagttcgagagacatcccaacagagaattgctgaaaggaaaagtc
gtcgccacactgttctttgaaccatccacacgcacccaactcagtttccagacggctgcc
aatcgcttaggagcccgtgtcatcggtttctctgacgccaaaacttccagcaccaccaaa
ggcgaaaccctgaaagacacgatactcatggtcagcaactatgccgacattatcgccatg
aggcaccacatagagggagcagcccagtatgccagcgaggttgttcccatccccatcatc
aatgccggcgacggagcacacatgcacccctcccaatgtatgctcgacctctattccatt
tacaagacgcagggcacgcttgaaaatctgaacatctaccttgtcggcgacctaaaatac
ggccggaccgttcactcgctgattacggccatgcggcacttcaaccccacctttcatttt
attgctcctgaagagctggccatgccccaagagtataaaatttattgcaagaagcataac
atcgaattccacgagcacaccgcatttaccgaagacgagattgcccatgcagacattctc
tacatgacccgcgtgcagaaagagcgcttctccgacttgatggaatacgaacgggttaag
aacgtctacattctccacgaatccatgctgcacaaggccaggcccaacatgaaaatcatg
cacccactgcctcgtgtcaacgaaattgcctacgacgtggacaacaatccacacgcctat
tacatccagcaagccaagaacgggctctacgcccgcgaagcgattttctgctattgcctc
ggtatcacgctcgacgatgtgcgcaacgacacgaccatcatccgctccgagtattga

DBGET integrated database retrieval system