KEGG   Prevotella dentalis: Prede_0757Help
Entry
Prede_0757        CDS       T02403                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pdt  Prevotella dentalis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:pdt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Prede_0757
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Prede_0757
Enzymes [BR:pdt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Prede_0757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:923590..924546
Genome map
AA seq 318 aa AA seqDB search
MEKHNFVTIADLSKEKILYLLDMAQEFERHPNRELLKGKVVATLFFEPSTRTQLSFQTAA
NRLGARVIGFSDAKTSSTTKGETLKDTILMVSNYADIIAMRHHIEGAAQYASEVVPIPII
NAGDGAHMHPSQCMLDLYSIYKTQGTLENLNIYLVGDLKYGRTVHSLITAMRHFNPTFHF
IAPEELAMPQEYKIYCKKHNIEFHEHTAFTEDEIAHADILYMTRVQKERFSDLMEYERVK
NVYILHESMLHKARPNMKIMHPLPRVNEIAYDVDNNPHAYYIQQAKNGLYAREAIFCYCL
GITLDDVRNDTTIIRSEY
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggagaagcataattttgtgacgattgccgatctgtccaaggagaagattctatacctg
ctcgacatggcgcaagagttcgagagacatcccaacagagaattgctgaaaggaaaagtc
gtcgccacactgttctttgaaccatccacacgcacccaactcagtttccagacggctgcc
aatcgcttaggagcccgtgtcatcggtttctctgacgccaaaacttccagcaccaccaaa
ggcgaaaccctgaaagacacgatactcatggtcagcaactatgccgacattatcgccatg
aggcaccacatagagggagcagcccagtatgccagcgaggttgttcccatccccatcatc
aatgccggcgacggagcacacatgcacccctcccaatgtatgctcgacctctattccatt
tacaagacgcagggcacgcttgaaaatctgaacatctaccttgtcggcgacctaaaatac
ggccggaccgttcactcgctgattacggccatgcggcacttcaaccccacctttcatttt
attgctcctgaagagctggccatgccccaagagtataaaatttattgcaagaagcataac
atcgaattccacgagcacaccgcatttaccgaagacgagattgcccatgcagacattctc
tacatgacccgcgtgcagaaagagcgcttctccgacttgatggaatacgaacgggttaag
aacgtctacattctccacgaatccatgctgcacaaggccaggcccaacatgaaaatcatg
cacccactgcctcgtgtcaacgaaattgcctacgacgtggacaacaatccacacgcctat
tacatccagcaagccaagaacgggctctacgcccgcgaagcgattttctgctattgcctc
ggtatcacgctcgacgatgtgcgcaacgacacgaccatcatccgctccgagtattga

  All links  
No link information was found.   
DBGET integrated database retrieval system