KEGG   Prevotella dentalis: Prede_0779Help
Entry
Prede_0779        CDS       T02403                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pdt  Prevotella dentalis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pdt00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:947496..948335
Genome map
AA seq 279 aa AA seqDB search
MLTFPCAKINLGLNIIAERADGFHDLETVFYPVPLTDVLEIKHMDPDFPSATPCDLKVTG
NAVDCDEAQNLVVKAYQLLAAEYEIPRIHAHLYKRIPSQAGLGGGSSDGAFMIRLLDERF
RLNIGIAEMERHAARLGSDCAFFITAEPSFATGRGEVLEPADGPRGNLKGYWLALAKPNV
AVSTREAYAQIRCQKPAKSCRDIVRQPIETWRRELTNDFETPVFKAHPVLADIKQRLYDL
GAVYAQMSGSGSAIFGIFRQEPAGLAQAFLGLFTHCARL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgctgacatttccctgtgcaaagataaacctcggactaaatatcatcgccgagcgtgcc
gatggtttccatgacttggaaaccgtgttctaccccgttcccctgaccgacgtgctcgaa
atcaagcacatggatcccgactttccctcggcgacaccctgcgacctcaaggtgacgggc
aatgccgtggactgcgacgaagcgcaaaatctggtggtcaaagcctaccaattgctggcc
gccgagtacgagataccgcgcatccatgcccacctctacaagcgcatcccctcgcaggcc
gggctgggcggcggctcgtccgacggggcattcatgattcgactgctcgacgagcgcttc
cgtctcaacattggcattgccgagatggagcgtcatgccgcccgtctgggctcagactgc
gccttcttcatcaccgccgaaccctcattcgccaccgggcgcggcgaagtgctcgaaccg
gccgacggcccacggggcaatctcaaaggctactggctggccctggccaagcccaacgtg
gccgtgtccacccgtgaggcttacgcccagattcgctgccaaaagccggccaagagctgc
cgcgacatcgtgcgccagcccatcgaaacctggcgtcgggagctcaccaacgacttcgag
acacccgtgttcaaggcccatcccgtgctggccgacatcaagcagcggctctatgacctt
ggggccgtctacgcccagatgagcggcagcggtagcgccatcttcggcatcttccgccag
gaacccgcggggctggcacaagccttcctcggcctcttcacccactgcgcccggctctga

DBGET integrated database retrieval system