KEGG   Prevotella dentalis: Prede_0866Help
Entry
Prede_0866        CDS       T02403                                 

Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
pdt  Prevotella dentalis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Prede_0866
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Prede_0866
Enzymes [BR:pdt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Prede_0866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1052495..1054567
Genome map
AA seq 690 aa AA seqDB search
MKQNRSFLVGLVCCVCLGLTPSETKAQQLLPLPNQLVYDSGKFRIHEQTGVYTNLESSQD
RRLTKTASGLLGMNLTSSEGKKKKGQLRLLLTNPAADPEQVPFDKQLQGYTLDATKEGVT
IKSRSEAGLYYGLQTLRGLLTGGEVPFVHVEDTPRFAYRGFMLDCSRHFWTVDFIKKQIE
MMARLKLNRLHLHLTDAAGWRMELKHYPELTQKTAYRTHSHWDKWWSSGDRRYCEADAAG
AYGGYYTQDDLREIVSYAALHHITVIPEIDMPGHSEEVTFALPQLSCDGKVYSDLCIGTE
ETFRFAENVLREVMDIFPSKYIHIGGDEAATEHWKTCKRCLQRMQDHHLNDVSQLQAYMM
KRINAFLQAHGRSLIGWDEMIDGGLPQGSTVMAWRSIDKGVEAIKAGHHVIMSPADWCYL
NFYQDNPFTQPEAMGGYTPLKVTYALEPVPEALADSAEISLIDGVQGNLWTEYIEHADRV
EYMAYPRLMAIAEIGWNGGAKDYAAFRERAQALADQMRTAGYHPFDLHHESGPRKESLTS
VSHAAIGKKVTYLSPYSEKYAAAGDATLTNGKQGDWSHKDGQWQGFIADKKMDVVVDMGQ
ETELIDISADFMQFAELWIFQPCELTISVSSDGKNYTPIDHRPSIKDEDKLSIRTYQWRG
HAKGRYIRYEARTDRDGGWLFTDEIVVNKQ
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaaccgttcgtttcttgtcggccttgtctgctgtgtgtgtctgggcttgacg
ccaagtgaaaccaaggcacagcaactgcttcccttgcccaaccagctcgtttacgactcg
ggaaaattccgtattcacgagcaaacaggcgtttataccaacctggagtcgtcccaagac
cgccgactgaccaaaacggcaagcgggctgttgggcatgaatctgacaagcagtgagggg
aagaagaagaaaggtcagctccgcctgttgctcacgaatccggcggccgacccggagcaa
gtgccgttcgacaaacagcttcaaggctatacgctggatgcgacgaaagagggcgtcacc
atcaagtcgcgttccgaggcgggcctttattatggtctccagaccttgcgggggctgctc
acggggggcgaggtgccgttcgtgcatgttgaagacacccctcgtttcgcttacagaggc
tttatgctcgactgttcgcgccatttctggacggtggatttcatcaagaagcaaatcgaa
atgatggctcgcctgaagctgaaccgcctccatctgcacctgaccgacgccgccggatgg
cgcatggagctcaagcattaccccgagctcacacagaaaacagcctaccgcacccactcc
cattgggacaaatggtggagcagcggcgaccggcgctactgcgaggcggacgccgccggg
gcgtatggcggctattatacgcaggatgatctgcgcgagatcgtaagctatgcggccctg
caccacatcaccgtgatacccgaaatagacatgcccggccacagcgaggaagtgacgttt
gccctgccccagctgtcctgcgacggcaaagtgtactccgatctgtgcatcggcaccgaa
gaaacgtttcggtttgcagagaacgtgctccgcgaagtgatggacatattcccttccaaa
tatattcatatcggcggagacgaggcggcaacagagcattggaagacgtgcaagcgttgc
ctgcagcgcatgcaagaccatcatctgaacgacgtgtcgcagctgcaagcctatatgatg
aagcgcatcaatgcctttcttcaggcgcacgggcgcagtctcatcggatgggatgaaatg
atagacggcgggcttccgcagggttccaccgtcatggcatggcgtagtatcgacaagggt
gtagaggccatcaaggccgggcaccatgttattatgagtccggcagactggtgttacctc
aatttctatcaagacaacccctttacccaaccggaagccatgggcggatatacccccttg
aaagtcacctatgccttagagcccgtgcctgaagcattggccgacagtgctgaaatcagc
ctgatcgacggcgttcagggcaatctgtggacagaatatatagagcatgccgaccgtgtg
gaatacatggcatacccccggctgatggccattgccgagataggatggaacggcggagcg
aaagactatgccgccttcagagagcgggcacaggccctggccgaccaaatgcgcacggcc
ggttatcatcctttcgacttgcaccacgagagtgggccgcgcaaggagagccttaccagc
gtgtctcatgccgccataggcaagaaagtaacctatctctcgccctactcggagaaatac
gctgcggccggcgatgccaccctcaccaacgggaagcagggcgactggagccataaagac
ggccagtggcaaggcttcattgccgacaaaaagatggatgtggtcgtcgacatggggcag
gaaacggagctgatcgacatatccgccgattttatgcagttcgctgaactttggatattc
cagccttgcgagcttacgatctccgtgtcttccgacggcaagaactatacgcccatcgat
catcgcccgtctatcaaagacgaggataagctcagcattcgcacttatcagtggcgggga
catgccaagggacgctacatacgctacgaggccaggaccgacagggacggcggatggctc
ttcaccgatgagattgtagtaaacaaacagtaa

DBGET integrated database retrieval system