KEGG   Prevotella dentalis: Prede_0888Help
Entry
Prede_0888        CDS       T02403                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pdt  Prevotella dentalis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Prede_0888
Enzymes [BR:pdt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Prede_0888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1073926..1075290
Genome map
AA seq 454 aa AA seqDB search
MKRDTIVIGAGITGLTCAFQLRRKGVDVAVLERQNRVGGQINTHRVDGFTFESGPNTGVV
KHAEVAELFEQLGANCRMETARESSKRRLVWKGDRFHELPSSLAGALATPLFSWSDKLRI
LGEPWRHKGTDPNESVGSLAERRLGKSYVDYAVDPFLSGVYAGDPYRLPTRLALPRLYQL
EQCYGSFIRGALAKARQPKTERDRKATKKVFSARGGFGTLTEALATAIGSDRIITSARHI
VVKPTAEGWRVTYEHNGEHCELTARRVVTTCGAYALPHLLPFVDGETMGRLSNLYYAPVV
QLGVGLRQTGGVDWPAFGGLVPSCERQQVLGILFPSACFDGRAPEGGAVMSCFLGGVRHP
DMLRMTDDGLTQLANRTLHDMLKYPAGTEASRVCVFRHERAIPQYELSTDDRLAAVARLR
EQFPTLTIAGNLRDGIGIGDRIKQGFDIANDERA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgagataccatcgtgataggagccggcattaccggcctgacctgcgccttccag
ctgaggcgcaagggcgtggacgtagctgtgctggagcgtcagaatcgggtgggcggccag
ataaacacccatcgtgtagacggtttcacctttgagagcgggcccaacacgggtgtggtg
aaacatgccgaggtggccgaactcttcgagcaattgggggcgaactgccgtatggagacg
gcccgcgagtcgagcaaacggcggcttgtctggaaaggagaccgcttccacgaactgccc
tcgtcgctggccggcgcactggccacgccgcttttcagctggagcgacaagctgcgcatc
ttgggagagccctggcgacacaagggaaccgacccgaacgagtcggtgggaagtctggcc
gaaaggcggttgggcaagtcgtatgtggactatgccgtagacccgtttctctctggtgtc
tatgcgggcgacccttaccggctgcccacgcgcctggccctgccccggctttaccagctg
gaacagtgctacggatcgttcattcgcggtgccctggccaaggcacgacagcccaaaacc
gagcgcgaccgcaaggccacgaagaaagttttctcggcccgaggcggcttcggcacactc
actgaagcccttgccacagccatcggcagcgaccgcatcatcacgtcggcccgccacatt
gtcgtgaaaccgacggccgaaggctggcgcgtgacctatgagcacaacggcgaacactgc
gaactcacggcgcggcgagtggttaccacctgcggggcctacgccctgccccacctgctg
ccctttgtagacggcgagacaatgggccgtctgagcaatctctattacgcccccgtggtg
cagttgggagtggggctgcgccagacaggcggggtcgattggcccgctttcggcggactg
gtgccctcgtgcgaacggcagcaggtgctgggaatactcttcccttcggcctgcttcgac
gggcgggcccctgagggcggggcggtcatgtcctgttttctgggcggtgtacgccacccg
gacatgctgcgcatgaccgacgacggactgacacagctggccaaccgcacgctccacgac
atgctgaaatacccggccggcaccgaggccagccgcgtgtgcgtcttccgtcacgagcgt
gccatcccgcaatacgagctgtccaccgacgaccggctggccgccgtggcccggttgcgc
gagcagtttcccacgctgaccatcgccggaaacctgcgcgacggcatcggcatcggcgac
cgaatcaagcagggcttcgacattgccaacgacgaacgggcctga

DBGET integrated database retrieval system