KEGG   Prevotella dentalis: Prede_0900Help
Entry
Prede_0900        CDS       T02403                                 

Definition
pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
pdt  Prevotella dentalis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Prede_0900
   00500 Starch and sucrose metabolism
    Prede_0900
Enzymes [BR:pdt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Prede_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1087740..1088717
Genome map
AA seq 325 aa AA seqDB search
MAKTFLLLLALAALLPVSAANKYDNPDTLFVARDGTAEFRTIGEALEVCRAFMEYHKVIF
VKRGTYKEKLVVPSWLTHIEICGEDRDHTIITYDDHANIRRPETGLPMGTFRTYTLKIEG
SDITLRNLAVENNAALLGQAVALHTEGDRLVFVNCRFLGNQDTVYTGAAGTRLYFKDCYI
EGTTDFIFGPSTAWFEHCTVHSKANSYVTAASTPASQPYGYVFSHCRLTAAPEATQVYLG
RPWRPYAYTLFIYSDLGRHIRPEGWHNWNNADNERTARYAEFGNTGAGASTASRAPWTRQ
LSRKEAAAVTPARVFDSHTTWLPAE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaacgttcctgcttctgctggccctcgcggccctgctgcctgttagcgcagcc
aacaaatacgacaatcccgacacgctgtttgtggcccgcgacggcacggccgagttccga
accatcggcgaagccctcgaagtgtgccgcgctttcatggaataccacaaggtcatcttc
gtgaaacggggcacctacaaggagaagctcgtggtgccttcgtggctcacccacatcgag
atttgcggcgaagatcgcgaccacaccatcatcacctacgacgaccacgccaacattcgc
cggccggagacggggttgcccatgggcacttttcgcacctacacgctcaagatagagggc
agcgacatcacgctcaggaacctcgctgtcgagaacaacgccgccctgctgggccaggcc
gtggccctgcacaccgagggcgaccgtctggtcttcgtcaactgccgcttcctgggcaat
caagacaccgtctacaccggggccgccggcacgcgcctctacttcaaggactgctacatc
gagggcaccaccgactttattttcgggcccagcacggcatggttcgagcactgcacggta
cacagcaaggccaacagctacgtcactgccgcctcgacgcccgcctcgcagccctacggc
tacgtcttcagccactgccgtctgaccgctgcccccgaagccacgcaggtgtacctcggc
cggccgtggcggccttatgcctacaccttatttatatatagcgacctcgggcggcacatc
cgccccgagggatggcacaactggaacaatgccgacaacgagcgcacggcccgctatgcc
gagttcggcaacacgggcgcaggggcttccaccgccagccgcgccccctggacccggcag
ctcagccgcaaggaggcggcagccgtcaccccggcccgcgtcttcgacagccacacgacg
tggctgcccgccgagtga

DBGET integrated database retrieval system