KEGG   Prevotella dentalis: Prede_0900Help
Entry
Prede_0900        CDS       T02403                                 

Definition
pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
pdt  Prevotella dentalis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pdt00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pdt00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1087740..1088717
Genome map
AA seq 325 aa AA seqDB search
MAKTFLLLLALAALLPVSAANKYDNPDTLFVARDGTAEFRTIGEALEVCRAFMEYHKVIF
VKRGTYKEKLVVPSWLTHIEICGEDRDHTIITYDDHANIRRPETGLPMGTFRTYTLKIEG
SDITLRNLAVENNAALLGQAVALHTEGDRLVFVNCRFLGNQDTVYTGAAGTRLYFKDCYI
EGTTDFIFGPSTAWFEHCTVHSKANSYVTAASTPASQPYGYVFSHCRLTAAPEATQVYLG
RPWRPYAYTLFIYSDLGRHIRPEGWHNWNNADNERTARYAEFGNTGAGASTASRAPWTRQ
LSRKEAAAVTPARVFDSHTTWLPAE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaacgttcctgcttctgctggccctcgcggccctgctgcctgttagcgcagcc
aacaaatacgacaatcccgacacgctgtttgtggcccgcgacggcacggccgagttccga
accatcggcgaagccctcgaagtgtgccgcgctttcatggaataccacaaggtcatcttc
gtgaaacggggcacctacaaggagaagctcgtggtgccttcgtggctcacccacatcgag
atttgcggcgaagatcgcgaccacaccatcatcacctacgacgaccacgccaacattcgc
cggccggagacggggttgcccatgggcacttttcgcacctacacgctcaagatagagggc
agcgacatcacgctcaggaacctcgctgtcgagaacaacgccgccctgctgggccaggcc
gtggccctgcacaccgagggcgaccgtctggtcttcgtcaactgccgcttcctgggcaat
caagacaccgtctacaccggggccgccggcacgcgcctctacttcaaggactgctacatc
gagggcaccaccgactttattttcgggcccagcacggcatggttcgagcactgcacggta
cacagcaaggccaacagctacgtcactgccgcctcgacgcccgcctcgcagccctacggc
tacgtcttcagccactgccgtctgaccgctgcccccgaagccacgcaggtgtacctcggc
cggccgtggcggccttatgcctacaccttatttatatatagcgacctcgggcggcacatc
cgccccgagggatggcacaactggaacaatgccgacaacgagcgcacggcccgctatgcc
gagttcggcaacacgggcgcaggggcttccaccgccagccgcgccccctggacccggcag
ctcagccgcaaggaggcggcagccgtcaccccggcccgcgtcttcgacagccacacgacg
tggctgcccgccgagtga

DBGET integrated database retrieval system