KEGG   Prevotella dentalis: Prede_1035Help
Entry
Prede_1035        CDS       T02403                                 

Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
pdt  Prevotella dentalis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pdt00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pdt00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1284684..1286312)
Genome map
AA seq 542 aa AA seqDB search
MKRQLFAALLALLALGGYAQQADYRVVPLPQSITPTRHPAFIFSATTPIVYEGEDADMKR
QAQFLADYIEQATGIKASVMNQKPKKTPAIVLVIDKKIEGPEAYRLTVTDNQVTLAGGTS
AGVFYAMQTLRKSLPTEVSGGTVALPATVVTDAPRFPYRGMMLDCARHFFPIDFVKQYID
LIALHNMNVFHWHLTDDQGWRIEIKKYPRLVEIGSMRSGTIMGHNSDVDDKQPHGGYYTQ
EQAREIVEYARQRHITVIPEVDMPGHTKAALAAYPELGCTSGPYEVGHHWGVYRDVFCLG
NERMYGFVQDIIDELVDIFPAKYFHIGGDETPTDRWATCPRCQKLAADHHLELNKMQAYF
TNRLEKYLNGKGRNIIGWDEILEGDINKSATIMSWRGVGPGQKGAEMGHDVIMTPVDYCY
FDYCQNKDEDTEPEGQHQYLPVSKVYSMNPAPADMPESVRKHVIGAQGNLWTEYIAWPSR
AEYGVLPRMAALCEGQWMDDEKKNFEDFTLRVTRLAKLYDRYGYTYATHLWPERFNHNRS
FW
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacaactgttcgcagctttgctcgcactgcttgcactggggggatatgctcag
caagctgactaccgcgtggtgcctcttccgcagagcatcacgcccacccgccacccggcg
ttcattttctctgccaccacgcctattgtctacgagggcgaggatgctgacatgaagcga
caagcacagttcctggccgattatatcgaacaggccacgggcatcaaagcctctgtaatg
aaccaaaagccgaagaaaacaccggccatagtgctggttattgacaagaagatcgagggg
ccagaggcctatcgactcaccgtgaccgacaaccaagttactcttgctggaggcacaagt
gcgggagtattctacgccatgcagacgttgcgcaagtcgcttcccactgaagtgtcaggt
ggcacagtagccctgccagccaccgtggtgacagatgcgccacgcttcccctaccgtgga
atgatgctcgactgtgcccgtcacttttttccaatcgatttcgtaaagcagtatattgac
ctcattgccctacacaacatgaatgtttttcattggcacctcactgatgaccaaggatgg
cgcattgaaatcaagaagtatcccagactggtggaaatcggttcgatgcgctctggtacc
atcatggggcacaattccgatgtggacgataagcagccccacggtggttattacacccaa
gaacaggcccgcgaaatagtggagtatgctcgtcagcgtcacattactgtcattcccgag
gtggatatgcctggtcatacaaaggctgcactggccgcctatcctgagctgggttgcacc
agtggcccctatgaggtgggtcaccattggggtgtctatcgtgacgtgttctgcttgggc
aatgagagaatgtacggattcgtgcaggacatcatcgatgaactggtggacattttcccg
gccaaatacttccatataggcggcgacgagaccccgacagaccgctgggcaacatgtccc
agatgtcagaaactggcggccgaccatcatttggaactgaataagatgcaggcctacttt
accaatcgtctggaaaaatatctcaatggcaaagggcgtaacattatcggatgggatgag
attcttgaaggtgacatcaacaagagtgcgaccatcatgagttggcgtggtgtaggtccg
ggacagaaaggggcagaaatgggtcacgatgtcattatgacccctgtggactattgctac
tttgactattgccagaacaaggacgaggacaccgagcccgaaggacagcatcagtatctg
ccagtctccaaggtgtacagcatgaatccagccccggccgacatgcctgaatccgtgcgc
aaacatgtgataggtgcccaaggaaacctgtggacagaatacatagcttggcccagccgt
gctgagtatggcgtgttgccgcgtatggccgccctgtgcgaaggccagtggatggatgat
gagaagaagaattttgaggatttcacccttcgtgtcacacgtttggccaagctctatgac
aggtatggctatacgtatgccacacacctctggccagaacgttttaatcataacaggtct
ttttggtaa

DBGET integrated database retrieval system