KEGG   Prevotella dentalis: Prede_1113Help
Entry
Prede_1113        CDS       T02403                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pdt  Prevotella dentalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Prede_1113
Enzymes [BR:pdt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Prede_1113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1394511..1397186)
Genome map
AA seq 891 aa AA seqDB search
MNLSFHVDYQTRFGEELVLNLVKQDGVAQYRMRTTDGSRWSCQLTMQPSKATIDYYYSVD
YAGTRERHEWTTVMHRLELCAAKGVEYTVYDHWTDIPEDSYLYSSAFTDCINRRETGALP
RTEYGRTVRLVVRAPQLRSGERLALVGAGDYLGNWEWDKALPMTEHNINEWAVDLNADAL
DSNVVEFKFAALGSGQASGPLWETGLNRTVELPPMTDGQVVVYHLDQAFLPVYNVKLAGT
LVPVFSLRSHSSFGVGDFGDLRRMVDYVEQSGQRVLQVLPINDTTITHTWTDSYPYSCIS
VFALHPQYVDLTRLPALKDEGQRARFEQLRQELNALDQIDYERVNQAKTEYLRLVFEQEG
KAMMASKAFRGFFKEAGQWLVPYAQYSMLRDRFGTADFSQWPDHRTWDEADRRDLSNSRT
KAYREVEFWYFVQFVLDSQFREVHDYARLHRVVLKGDIPIGVNRYSCDVWMEPKYFNLNG
QAGAPPDDFSVNGQNWGFPTYNWDEMLKDGCRWWVRRFQSMARFFDAYRIDHVLGFFRIW
QIPGDAVHGLLGQFSPALGMTREEIEGYGLLFQEHQFCDPFISDWIVERVFGERADEVKQ
KYLDHAHDDVWNMKPEYATQRKVERAFAGVTAQSELNLRDGLYALISNVLFVRDAREPGK
YHPRISAQFDFTYEALYDSDKAAFNRLYNDYFYRRNNQFWYREAMKKLPRLVEATRMLVC
AEDLGMVPDCVSWVINALRILSLEIQSMPKDPHVRFGHLSRNPYRSVCTFSTHDMPTMRQ
WWDENIDRTQDYYNSMLHRGGAAPHPLPGWLARDIVSRQLTSPSMLCVLSIQDWLAGDER
LRLPDADAERINVPANPRHYWRYRMHLCIEDLMADEAFMESVRELVYQSGR
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatcatttcatgtggattaccagactcggttcggcgaggaactcgtgctgaat
cttgtcaagcaggacggcgttgcccagtaccgtatgaggacgaccgatggtagccggtgg
agctgccagctcaccatgcagccctcgaaagcgacaatcgactattactatagcgtggac
tacgccggcacacgggagcgtcatgagtggaccaccgtgatgcaccggctggagctctgt
gcggccaagggcgtggaatacaccgtctacgaccactggaccgacattcccgaagactcc
tatctctacagttcggccttcacagactgtatcaaccgccgcgagacgggcgcattgccc
cgcacggagtatggccggacggtgcgccttgtggtgcgcgcccctcagttgcgcagcggc
gagcggctggccctggtgggcgcgggtgactatctgggcaactgggaatgggacaaggct
ctgcccatgacggagcacaatatcaacgagtgggccgttgatctgaacgccgatgccctc
gactccaatgtggtggagttcaagtttgccgccctcggcagcgggcaggcttcgggccca
ctttgggagacggggctgaaccgcaccgtggaactgcccccgatgaccgacgggcaagtg
gtggtttaccatctcgaccaggccttcctgcccgtctacaacgtgaagctggccggcacg
ctggtgcctgtattctcgctgcgctcgcacagcagcttcggcgtgggcgacttcggcgac
ctgcgccgcatggtagactacgtggagcagagcggtcagcgcgtgctccaggtgctgccc
atcaacgatacaaccatcacccatacctggaccgactcctatccctatagctgcatcagc
gtgtttgccctgcatccgcagtatgtggatctgacccggctgcccgccctcaaggacgag
gggcagcgggcacggttcgagcagttgcgccaggagctcaacgccctcgaccagatagac
tacgagcgtgtgaaccaggccaagaccgagtatctgcgcctggtgttcgagcaggaggga
aaggccatgatggcctccaaggctttccgcgggttcttcaaggaggccgggcagtggctt
gtgccctacgcacagtacagcatgctgcgcgatcgcttcggcacggccgacttctcgcag
tggcccgaccaccgtacgtgggacgaggccgaccgccgcgacctgtccaacagccgtacc
aaggcctatcgggaggtggagttctggtactttgtgcagttcgttctggatagccagttc
cgtgaagtgcacgactatgcccgtctgcaccgcgtggtgcttaagggcgacatccccatc
ggtgtgaaccgctacagctgcgacgtgtggatggaaccgaaatatttcaacctgaacggc
caggccggtgccccccccgacgacttctcggtgaacggccagaactggggcttccccacc
tacaattgggacgagatgctcaaggacggctgtcggtggtgggtgcgccgcttccagagc
atggcccgcttctttgacgcctaccgcatcgatcacgtgctgggcttcttccgcatttgg
cagattcccggcgatgccgtgcacggattgctgggacagtttagccccgcactcggcatg
acgcgcgaggaaatcgagggctatggcctccttttccaggagcaccagttctgtgacccg
ttcatttccgactggatcgtcgagcgcgtgtttggcgagcgcgccgacgaggtgaagcag
aagtacctcgaccatgcccacgacgacgtatggaacatgaagcccgagtatgccacgcag
cgcaaggtggagcgtgcctttgccggtgtcaccgcacagagcgagctcaatctgcgcgac
ggcctctatgctttaatctccaatgtgctcttcgtgcgcgacgccagggagcccggcaag
taccatccgcgcatctcggcacagttcgatttcacctacgaggccctctacgacagcgac
aaagctgccttcaaccgcctctacaacgactatttctatcgccgcaacaaccagttctgg
tatcgcgaggccatgaagaagctgccacgactggtcgaggccacgcgcatgcttgtgtgt
gccgaggacctcggcatggtgcccgactgcgtgtcatgggtcatcaatgccctgcgcatt
ctctcgctcgaaatccagtctatgcccaaggatccgcacgtgcgcttcggccatctctcg
cgcaatccctaccgttccgtctgcacattctccacccacgacatgcccaccatgcgccag
tggtgggacgagaatatcgaccgcacgcaggattattacaactctatgctccatcgcggc
ggtgcagccccgcacccgttgccgggctggctggcccgcgacatcgtgtcgcggcagctc
acctcgccctcgatgctctgcgtgctgagcattcaggactggctggccggcgacgagcgg
ctgcggctgcccgacgccgacgccgagcgtatcaacgttcccgccaaccccaggcactac
tggcgctaccgcatgcacctctgcatcgaggacctgatggccgacgaagccttcatggag
agcgtgcgcgagctggtgtaccagagcgggaggtaa

DBGET integrated database retrieval system