KEGG   Prevotella dentalis: Prede_1308Help
Entry
Prede_1308        CDS       T02403                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pdt  Prevotella dentalis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pdt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Prede_1308
  Lipid metabolism
   00561 Glycerolipid metabolism
    Prede_1308
   00600 Sphingolipid metabolism
    Prede_1308
Enzymes [BR:pdt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Prede_1308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1650209..1652278)
Genome map
AA seq 689 aa AA seqDB search
MWRLLLAVGLCVLPAVEALAQNSFKLSRRAPDVERWIKSAFARGRVPPFSFVYDGQSSAS
FIRSWTYQAVRHGRTAPGQVAYTFTYTHPQDGLRVSCDVTGYPDYGSVDWILRVENTGTT
DSRPLQQVQAIDLSLRYGRPGRFLMNYLEGNQISPADFQPRQITLPTGQPVGMSPEGGRS
SQGKYTPFFCITSPQGGGVVLSIGWTGNWLAEVCAQSDREVSLVAGQKRISLYLHPSEQI
RTPRINLMFWEGQDYLDGTNQFRRLVLAHNSRRVDGQVAWYPFSTGFNYHEPQPMQEYSC
LTRQYAIAMVKRNYRFGIRPDVFWLDAGWHQDAGDYQYGRNWANTTGNWTVDTTRFGHTL
RPIADEIHRHGAKFMVWFEPERVVDGTQWAVEHFDWMLRHPKGGDWLLFNLANREACDWL
CRYYGDMIARNGIDYYRQDCNIEPEKYWEANDEPGREGLTEIRYIEGLYRFWDYLLQRFP
QLLIDNCASGGRRIDWETMGRSAPLWQSDYYHYYATEGLQTQNYGLNLFVPFHGTGVVTA
DAYAARSSYSSAMVCHWKLTTKQTNLETVHRCIDEYQSVRPYYIEDYYPLTGSNTATDAN
SWMAYQLHRRSDGTGIVVAFRRPECQDSTTVVRLRGLREGGSYELVNADTGETTVCTGRS
LSDGLVLRLGTPRSSLLFRYKEVGQQSSF
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggcttctcttggcggtggggctttgtgtgctccccgccgtggaggccttggcg
cagaacagcttcaagctgagccgtcgcgcgccagacgttgagagatggatcaagagtgcc
tttgcccgtggcagggtgccgccattctcgttcgtctacgacggccaatcctcggcctcg
ttcatcaggtcgtggacttatcaggccgtgcgccacggccgcacagcccccggtcaagtg
gcctacacattcacttacacccatcctcaagacggtctccgggtgagctgcgacgtcacc
ggctatccagattatggtagcgtggactggatattgcgcgtagagaacacgggcaccacc
gactcccggcccctgcagcaggtacaggccatcgacctgtccctgcgctatggccgcccg
ggccgcttcctcatgaattacctggagggcaaccagatcagcccggcagactttcaaccc
cggcagatcacactgcctacgggccagcccgtcggcatgtcgcccgagggaggacgctcc
agccagggcaagtacaccccattcttctgcatcacttccccgcagggtggtggtgtcgtg
ctgagcatcgggtggaccggcaactggctggccgaggtctgcgcacagagtgatcgcgag
gtcagcttggtggcggggcagaagcgaatcagcctctacctccatccctccgagcagatt
cgcaccccccgcatcaacctgatgttctgggagggacaggactatctggatggcaccaac
cagtttcgccggctggtgctggctcacaacagccgccgtgtagacgggcaagtggcctgg
tatccgttctccacggggttcaattatcacgagccccagcccatgcaggagtattcctgc
ctcacccggcagtatgccattgccatggtgaagcgcaactatcgcttcggcatccgcccg
gatgtgttctggctcgatgcgggctggcatcaggacgccggcgattatcagtatgggcgc
aactgggccaacaccacgggcaactggacggtcgacaccacacgcttcggtcatacgctc
cggcccatagccgacgagattcaccgccatggggccaagttcatggtgtggttcgagccc
gagcgtgtggtggacggcacgcagtgggccgtcgagcacttcgactggatgctgcgccac
cccaaagggggcgactggctgctcttcaacctggccaaccgcgaggcctgcgactggctg
tgccggtattatggcgacatgatagcccggaacggcatcgactactaccggcaggactgc
aacatcgagcccgaaaaatactgggaggccaacgacgagccgggtcgcgagggcctcacc
gagattcgctacatcgaggggctttatcgcttttgggactatctgttgcagcgtttccca
cagttgctgatagacaattgcgccagcggcggtcgccggatagactgggaaaccatgggc
cggagcgccccgctctggcagagcgactactatcactattatgccaccgagggcctccag
acgcaaaactacgggctcaacctcttcgtgccgttccatggcacgggtgtcgttacggct
gatgcctatgcggctcgctccagctacagctcggccatggtgtgtcattggaagctgaca
accaagcaaaccaacctggaaaccgtgcatcgctgcatcgacgaataccagtcggtcaga
ccttattatatagaggactattacccgctgacgggcagcaacacggctacggacgccaac
agctggatggcctatcagctccaccgccggtcagacggcacgggcatcgtcgtggctttc
cgtcgccccgagtgccaggacagcaccaccgtggttcggctgcggggtctgcgcgagggc
ggcagctacgagctggtcaacgccgacaccggggagaccaccgtttgcaccggccgctcg
ctgtccgacgggctggtgctccgtctgggcaccccgcgctcttcgctgctgttccgatat
aaagaggtggggcagcaaagttcattctaa

DBGET integrated database retrieval system