KEGG   Prevotella dentalis: Prede_1313Help
Entry
Prede_1313        CDS       T02403                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pdt  Prevotella dentalis
Pathway
pdt00010  Glycolysis / Gluconeogenesis
pdt00052  Galactose metabolism
pdt00500  Starch and sucrose metabolism
pdt00520  Amino sugar and nucleotide sugar metabolism
pdt00521  Streptomycin biosynthesis
pdt01100  Metabolic pathways
pdt01110  Biosynthesis of secondary metabolites
pdt01120  Microbial metabolism in diverse environments
pdt01130  Biosynthesis of antibiotics
pdt01200  Carbon metabolism
Module
pdt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pdt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Prede_1313
   00052 Galactose metabolism
    Prede_1313
   00500 Starch and sucrose metabolism
    Prede_1313
   00520 Amino sugar and nucleotide sugar metabolism
    Prede_1313
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Prede_1313
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Prede_1313
Enzymes [BR:pdt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Prede_1313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase RuvC
Motif
Other DBs
NCBI-ProteinID: AGB28635
UniProt: L0JAR8
Position
1:complement(1659260..1660219)
Genome map
AA seq 319 aa AA seqDB search
MKENLIGIDIGGTKCAVSYGRWEADELVVVDKIRFATTEVNETIGRICQSVSQMLDKYQL
NRENTRGIGISCGGPLSSQKGIIMSPPNLIGWDNVSIVKTIEELTHIPTHLQNDANACAL
AEFRFGAGRGSRNMVFLTLGTGLGAGIIIDGKLYSGTNDNAGEVGHIRLADFGPVGYGKK
GSFEGFTSGGGIAQIACSLIMEQWQQGNRVSWCEYGGLDKVTTRLVAEQATKGDAVARHA
FDIAAEYLGRGLAILIDTLNPEVIVIGSIFTRCEHLLRPRMQQVIDREALSCSRQVCVVK
RAALDEQIGDYAALSVALV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaacctgatcggaatagacattggcggtaccaagtgtgccgtgtcttatgga
cgttgggaagcggatgagcttgttgttgtcgacaagatccgatttgcgacgaccgaagtc
aatgagaccatcgggcggatttgccaaagtgtgtctcagatgcttgataaatatcagctg
aatcgggagaatacaagaggcatcggcatctcttgcggcgggccgttgtcgagtcagaaa
gggatcatcatgtcgccccccaacctgatagggtgggataacgtctctattgtgaagaca
atagaagaactgacccacattcccacgcatctgcagaacgatgccaatgcttgcgctttg
gccgagttccgctttggtgccggccgtggttcccgcaacatggtgttccttacgcttggc
accggcttgggggctggtatcatcattgatggaaaattgtacagtggcaccaacgacaat
gccggtgaagtggggcacattcgcttggccgattttggcccggtgggctacggcaagaaa
ggttcgttcgagggatttaccagtgggggcggcattgcacagattgcatgctctctgatt
atggagcaatggcaacagggaaatagagtctcttggtgtgagtatggcggtctggataag
gtgaccacgcggcttgttgccgagcaggccaccaagggcgatgccgtggccaggcatgct
ttcgatattgctgcggagtatcttggtcgtggattggccattctcatagacaccttgaat
cccgaggtcatcgttattggcagcatttttacccgttgtgagcatctgctccggccccga
atgcagcaggttatcgatcgggaggctttgtcgtgctcccgtcaggtgtgtgtagtgaag
cgcgctgccttggacgaacagatcggagattacgccgctttgtccgtggcacttgtttaa

DBGET integrated database retrieval system