KEGG   Prevotella dentalis: Prede_1560Help
Entry
Prede_1560        CDS       T02403                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pdt  Prevotella dentalis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Prede_1560
   00670 One carbon pool by folate
    Prede_1560
Enzymes [BR:pdt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Prede_1560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(73531..73998)
Genome map
AA seq 155 aa AA seqDB search
MPISLVAALAANRAIGFRRQLLWHLPEDLHRFKALTLGHAVVMGRKTFESLPHGALPHRR
NIVLSRSVRRLPGCEVYASLEAALAACGGENEVMVIGGESLYRQTLPLAHRLYLTHVDAE
PALADAWFPEIVAADWRIVRREQRPGFTFVDYERV
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgccgattagccttgttgccgccctggccgccaaccgggccatcggcttccgccggcaa
ttgctctggcacctgcccgaagatctgcaccgtttcaaggccctcacgctgggccatgcc
gtcgtcatggggcgcaagactttcgagtcgctgccccacggcgccctgccccaccgccgc
aacatcgtgctcagccgcagcgtgcggaggctgccgggctgcgaggtgtatgcctcgctg
gaggcagcactggcggcttgcgggggcgagaacgaggtgatggtgattggcggcgagagc
ctctaccggcagacactgcccctggcccacaggctctatctcacccacgtcgatgccgag
cccgccctggccgacgcctggtttcccgagattgtcgccgccgactggcgcatcgtgcgc
cgcgaacagcgccccggcttcacgttcgtagactacgaaagggtttag

DBGET integrated database retrieval system