KEGG   Prevotella dentalis: Prede_1617Help
Entry
Prede_1617        CDS       T02403                                 

Definition
hypothetical protein
Organism
pdt  Prevotella dentalis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:147805..149304
Genome map
AA seq 499 aa AA seqDB search
MKKIFYVATVLTIGLWSCGNKFGVQSNDWELKYSNGIKVYHAGQEIAGDVHAEYSIDNNI
VTDKEYSAPRFQIQNINDRFGKGKKWTIIYSSKRHPTLTHTFRIYKDFLLTDIEISSKSK
ELKTNYMVPVVAYTDTLLYSQNRRKLFVPFDNDAWIRYATTTHIDSTLRSYEVTSVYDAR
QRDGVVMGAVNHDRWKNAVELSDKQKSLKMYSGIADKLTRDTRSHGFLKGKDIKSATFMI
GHFKDWRDGMERYADNNAIVAPRRAWGKAMPVGWNSWGALAFDVNHTNSTEVVKFFANEL
QPHAFVNPDGLLYTGLDSGWNSFSEPDLKDFANQCKANNQVPCIYWTPFTDWGKDPEREV
PGTSYKYKDVYLYANGKPQELDGAYAIDPTHPAIKKTMEDVAALFRKCGYKYVKMDFMTH
GRMEADHWYKKDITTGTEAYNYGMQLLDSVFHDMYLNLSISPIFPAQYAQSRRIACDAWN
KIKDRQSLPIQRCRPCGIA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatattctatgttgccacagtgctaaccataggtttgtggtcatgtggaaac
aagtttggcgttcagtccaacgattgggaattaaagtattctaacggtatcaaggtatat
cacgccggacaggaaatagccggtgacgtccatgctgaatacagtatcgacaacaacatc
gttactgacaaggagtactcggctccaaggtttcagatacaaaatataaacgaccggttt
gggaaaggtaagaaatggaccattatctattcttccaagaggcatcctacgctgactcat
acctttcgcatttataaggatttcttactcacggacattgagatttcgtccaagtcgaag
gaactgaagaccaactacatggtacccgtggtagcctatacggacaccttgctctattct
cagaacaggcgcaaactctttgtacctttcgacaatgacgcttggatccgctacgccacc
accacccatattgacagtacgctgcgcagctatgaggtgacaagcgtgtatgatgcacgt
cagagagacggggtcgtgatgggtgcagtcaatcacgacaggtggaagaatgctgtggaa
ctgagcgacaagcaaaagtctctcaaaatgtacagcggcatagccgacaagctaacccgt
gacacccgttcccacggatttctcaagggaaaagacatcaagtcggctacattcatgatt
ggtcatttcaaggattggcgtgacggcatggagagatacgcggacaacaatgccatcgta
gccccacgccgtgcatggggcaaggctatgcccgtaggctggaacagttggggggcactg
gcgttcgatgtaaaccataccaattctacagaagtggtgaagttttttgccaatgaactg
cagcctcacgctttcgtcaaccccgacggtctgctctacacggggctggactcgggctgg
aatagcttcagcgaacctgaccttaaagactttgcaaaccagtgcaaagccaacaaccag
gtgccttgcatctattggactcctttcaccgactggggaaaggatccggagcgtgaggtg
ccgggaacctcctataaatataaggatgtgtatttatatgccaatggcaagccgcaagaa
ctggatggggcttacgccattgatcctacccatcctgccatcaagaagacgatggaagat
gttgccgcgctattccgtaaatgtggatataaatatgtaaagatggacttcatgactcat
gggcgcatggaagccgaccattggtacaaaaaggacattactacaggcacggaagcctat
aactatggcatgcagttgctcgacagcgttttccacgacatgtatctcaacctctccatc
tctcctattttccctgctcaatatgcgcagtctcgccgaattgcctgcgacgcatggaac
aagataaaagatagacagagtttaccgatacaacgatgccgaccatgtggtattgcgtga

DBGET integrated database retrieval system