KEGG   Prevotella dentalis: Prede_1618Help
Entry
Prede_1618        CDS       T02403                                 

Definition
(RefSeq) hypothetical protein
Organism
pdt  Prevotella dentalis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:149758..152115
Genome map
AA seq 785 aa AA seqDB search
MLLLVVSLMAQAQQVKHGNWEISLDKNSKLMNIKKDGSMALSNVYASANFGFDGTDRKLA
TVKSTEAISTSFEEEEVADCFGTGKKYEFVYRFGSGLVMTQTFAFYDNKDLFFTQLSLSA
ESESMILRSNHLVPLATSTAQAIMPGDKTNRMLWVPWDNDGFIGYAANFLRTDMNSYNVT
AIYHPADRYGLVMGAVDHDLWKNAIHVNATEYNKINELELMSGYTDEHSHDSIQLERRSY
PHGTVKAATITSARFMFGCFDDWRLGMDTYGRSCAMVSPRREWDGGTPYGWSSWGVMQTK
ISYDAIMDVADFLKDNVRIHGFHDEKGRIVLSLDAWWNDNLSLAQIKQFVAYCKENKMIP
GLYYGPFCDFGGYDNNDVPGTGGRYKYKDLWLKQNGSYKKIDGAYCLDPTHPGNKLFMAH
DMKKFKDWGIEYLKCDFMSNGAIEADSWYDSQCYTGMQAYNMGMAFLRKQAGDNIYLLLS
IAPMFPAHYAHGRRISCDAWGSIDNTKYVMNNSSYGWWLNQVYFANDPDHLVMKTLDRNG
KESEGVNRARITSGVITGSFIIGDNFSDRVDAGYPSLSRERTLALLINEEINEIPRTCQA
FRPVEGNASSSQNAENLMTYENDKYVYLAAINYGKSVFASLKDNIPFERLGVDADRVEEI
KELWTGNPVAVSSAGFTYDVPFSDARIYRITKKHSANSIPDIKKGHNSHIDIQTRGRKIS
VSSPQEDVQNIAVYDAMGQVVLRQEGTKGKRYYDLSMEDCAAGIYIIQAIGSKEKKSHKV
VLSSK
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
gtgttattgcttgttgtgtcgctgatggcacaagcgcaacaggtcaagcatggcaactgg
gaaatcagtttggacaagaactccaagttgatgaatatcaaaaaagacgggagcatggct
ctctcaaacgtctatgcgtctgccaatttcggatttgatgggacagaccgcaagctcgcc
accgtgaaatcgaccgaagccatcagcaccagctttgaagaagaagaggtagccgactgc
tttgggactggaaagaaatatgagtttgtctatcgcttcggaagcggactcgtcatgact
cagacctttgctttctatgacaataaagatttgtttttcactcagctctcactttcggca
gaaagtgaatccatgatacttaggagcaatcatcttgtaccattggctacttccactgct
caagcaattatgcctggtgacaagaccaaccgtatgttgtgggttccatgggacaatgat
ggatttattggttacgcagccaacttcttgcgtaccgatatgaactcgtacaatgtaacg
gccatctatcatccggccgaccgatatgggttggtaatgggggctgtggaccatgacttg
tggaaaaatgccattcatgtgaatgctacagaatacaataagataaacgagttggaatta
atgtctggttatactgacgagcacagccatgactccatccagctagaaagaagaagttat
ccccatggtacagtaaaggctgcaacgataacctctgcaaggtttatgtttggctgtttt
gatgactggcggttaggcatggatacctacggcaggagttgcgctatggtcagccctcgc
cgagaatgggacgggggaactccttacggctggagcagttggggagtcatgcaaaccaag
atttcatacgacgccatcatggatgttgctgattttttgaaagacaatgtgaggattcat
ggattccacgatgagaaaggcaggattgtgttgagcttggacgcatggtggaacgacaac
ctttctttagcccaaatcaagcagttcgttgcttactgcaaagagaataagatgatacct
ggtctttattacggaccattctgtgattttggcggctatgacaacaacgatgtaccaggt
accgggggcagatataaatacaaagatttatggctcaagcaaaatggcagttacaagaag
atagacggtgcttactgcctcgacccaacgcatcctggtaacaagctctttatggcgcac
gatatgaagaaattcaaggattggggcattgagtatttgaaatgcgactttatgagcaat
ggagccatagaggcggacagttggtatgacagccagtgctatacaggcatgcaagcctac
aacatgggcatggcttttctcagaaagcaagcgggcgacaacatatatctgctcttgtcc
attgctcctatgttcccagcccattacgctcatggccgtcgtatcagttgtgacgcatgg
ggatctattgacaacacaaagtatgtcatgaacaatagttcttacggatggtggctcaac
caagtatatttcgccaatgatccggatcacttggttatgaaaactcttgatagaaatggt
aaagaaagcgagggggtaaacagggcacgcatcacctcgggagtcataaccggttccttt
attataggtgacaactttagtgacagggtggatgcaggctatccatccttatcaagagaa
aggactctcgccctgcttatcaacgaggaaatcaacgagataccccgcacttgccaagct
tttcgcccggtagagggaaacgcctcttccagccaaaacgcagaaaacttgatgacctat
gagaatgataagtatgtgtatcttgccgccatcaattacgggaagtctgtctttgcttcg
cttaaagacaacataccctttgaacgattaggcgtggatgccgatcgtgtggaggagatc
aaggaattatggactggcaatcctgttgctgtttcatccgcaggttttacatatgatgtt
cctttcagtgatgcccgtatctatcgcattacaaaaaaacattcagcaaatagcatcccc
gacatcaagaaagggcataactcgcatattgacatccagacaagaggaagaaaaatctct
gtgagttccccacaagaggacgtgcagaatattgctgtctacgatgccatggggcaagtg
gtgctgagacaagaaggcaccaagggcaaacgctattatgacctgtcaatggaagattgt
gctgctggcatatacattattcaggcaatcggctcaaaagaaaagaagagccataaggta
gtactctcgagcaagtaa

DBGET integrated database retrieval system