KEGG   Prevotella dentalis: Prede_1762Help
Entry
Prede_1762        CDS       T02403                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pdt  Prevotella dentalis
Brite
Enzymes [BR:pdt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Prede_1762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(333411..334499)
Genome map
AA seq 362 aa AA seqDB search
MLLSAFWAGLAAQAQQPGLKDALGPYFQVGVALNTRITAGGDAQADALVDRHFNTIVAEN
CFKGGEVTPREGVYDFTDADAVVSYAEKHGLRLIGHCLVWHSQAPDWFFKHADGTVVSRD
ELIRRMQTHIRTMVGRYKGKVYGWDVVNEAVEDNGEFRRSPYYNIIGPEFIDIAFRTAHE
ADPDAELYYNDYSMAKPGKRTAVCRLVRHLQSEGLRIDAVGMQSHQGLDYPDLADYEASI
DSFAACGVKVSLSELDLNVLPSPRNFGGAGIEQNYAFQQPMNPYADGVPADVQRQIDARW
MDFFRIYRRHASQIERVTLWGLTDGGSWLNDWPIRGRTNYGLLFDRQGRAKPVVDQIVNL
FK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgctcttgtcggctttctgggccggcctggccgctcaggcccaacagccggggctgaaa
gacgccctcggcccttactttcaggtgggcgtggccctcaacacccgcattacggccggc
ggcgacgcgcaggccgatgcgctggtcgaccgacatttcaacaccattgtggccgagaac
tgcttcaagggcggcgaggtcaccccccgcgagggagtctacgatttcacggatgccgat
gccgtggtgagctatgccgagaagcacgggttgcgcctcatcggccattgtctggtgtgg
cactcgcaggctcccgactggtttttcaagcatgccgacggcaccgtcgtctcgcgtgac
gaactgattcgccgtatgcagacccacatccgcaccatggtgggccgctacaaaggcaag
gtctatggctgggacgtggtgaacgaggccgtcgaggacaatggcgagttccgccggtca
ccttattataatatcatcggtcccgagttcatcgacattgccttccgcacggcccatgag
gccgaccccgatgccgaactctactacaacgactactccatggccaagcctggcaaacgg
acggccgtgtgccgcctcgtgcgtcacctccagtccgaggggctgcgcatcgatgccgtg
ggcatgcagagccaccagggactcgattatcccgacctggccgactatgaggccagcatc
gacagctttgcagcctgcggtgttaaggtgagcttgagcgaactcgacctcaacgtgctg
ccctctccccggaatttcggaggggccggcatagagcagaattacgcgttccagcagccg
atgaacccctatgccgacggagtcccggccgacgtgcagcggcagatcgacgcacgctgg
atggacttcttccgcatctaccgccgccatgccagccagatagagcgcgtcacactgtgg
ggactcaccgatggcggctcctggctcaacgactggcccatccgtggacgcaccaattat
gggctgctcttcgaccgccaaggcagggccaaaccggtggtggatcagattgtcaacctc
ttcaaataa

DBGET integrated database retrieval system